(data stored in ACNUC7421 zone)

EMBL: CP002355.PE263

CP002355.PE263       Location/Qualifiers
FT   CDS_pept        253017..253406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0264"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0838 NADH:ubiquinone oxidoreductase subunit
FT                   3 (chain A); InterPro IPR000440; KEGG: tdn:Suden_1829 NADH
FT                   dehydrogenase subunit A; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 3; SPTR:
FT                   NADH-quinone oxidoreductase subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32931"
FT                   /db_xref="GOA:E4TY18"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY18"
FT                   /protein_id="ADR32931.1"
FT                   /translation="MEHYNTANPYFGVFVLFVLTFGAFYATTVIARLASRALAAKDTEK
FT                   LKMTVYECGPEVTKQPNRISTQFYLFALLFLLFDVEIVFMFPWAIDFKLLGWFGFVEMM
FT                   MFILLLAIGFVYAWKKGALEWHNIK"
     atggagcatt acaacacagc aaatccttat ttcggggtat ttgtactgtt cgtgttgacg        60
     tttggtgcat tttatgccac aaccgtcatt gcacgtttag ccagccgcgc attagcggct       120
     aaagacacag aaaaacttaa aatgaccgtc tacgaatgcg gaccggaagt gacaaaacag       180
     ccgaaccgta tttcgacaca gttttatctg ttcgcattgt tgttcttgtt gtttgatgtt       240
     gagattgttt tcatgtttcc gtgggcaatc gattttaaac tcttgggttg gttcggattt       300
     gtcgagatga tgatgttcat cttattgttg gcaatcggtt tcgtttacgc gtggaagaag       360
     ggggctctcg aatggcacaa catcaagtaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page