(data stored in ACNUC7421 zone)

EMBL: CP002355.PE264

CP002355.PE264       Location/Qualifiers
FT   CDS_pept        253388..253897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0265"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0377 NADH:ubiquinone oxidoreductase 20 kD
FT                   subunit and related Fe-S oxidoreductase; InterPro
FT                   IPR006138: IPR006137; KEGG: tdn:Suden_1828 NADH
FT                   dehydrogenase subunit B; PFAM: NADH ubiquinone
FT                   oxidoreductase 20 kDa subunit; PRIAM: NADH dehydrogenase
FT                   (quinone); SPTR: NADH dehydrogenase i chain b; TIGRFAM:
FT                   NADH-quinone oxidoreductase, B subunit; PFAM: NADH
FT                   ubiquinone oxidoreductase, 20 Kd subunit; TIGRFAM:
FT                   NADH-quinone oxidoreductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32932"
FT                   /db_xref="GOA:E4TY19"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY19"
FT                   /protein_id="ADR32932.1"
FT                   /translation="MAQHQVNYLKDGGLPVALTTIDKVVNWGRSNSLWALTYGLACCGI
FT                   EMMASGASRYDFDRFGTIFRASPRQAELMVVAGTLTKKHAEFIRRLYDQMTEPKWVISM
FT                   GSCANTGGMFNTYATVQGVDRVIPVDLYLPGCAPRPETLQYAVLLLQQKIRRESASRAQ
FT                   KPKRLM"
     atggcacaac atcaagtaaa ttacttaaaa gacggcggac ttcccgtcgc attgacgacc        60
     atcgacaaag tggtcaactg gggacgctcg aattcacttt gggcattgac gtacggtttg       120
     gcgtgctgcg gtatcgaaat gatggcatcg ggtgcgtcac ggtatgactt cgaccgtttc       180
     ggtacgattt tccgggcttc tccgcgtcaa gccgagctga tggttgttgc gggaacgcta       240
     acgaaaaaac atgcggaatt tattcgtcgt ctctacgatc aaatgacgga gcctaaatgg       300
     gttatctcta tgggttcgtg tgcgaacacc ggcggtatgt ttaatactta cgctaccgtt       360
     caaggggtag accgcgtcat ccctgtagac ttgtaccttc cgggatgtgc tccgcgcccg       420
     gaaactttgc aatatgcggt attgctgttg cagcaaaaaa tccgacgtga aagcgcatcg       480
     cgtgcgcaaa aaccgaaaag gctgatgtaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page