(data stored in ACNUC7421 zone)

EMBL: CP002355.PE265

CP002355.PE265       Location/Qualifiers
FT   CDS_pept        253897..254703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0266"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0852 NADH:ubiquinone oxidoreductase 27 kD
FT                   subunit; InterPro IPR020396: IPR010218: IPR001268; KEGG:
FT                   tdn:Suden_1827 NADH dehydrogenase subunit C; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 30 kDa subunit; SPTR:
FT                   NADH-quinone oxidoreductase; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C; PFAM: Respiratory-chain NADH
FT                   dehydrogenase, 30 Kd subunit; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32933"
FT                   /db_xref="GOA:E4TY20"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY20"
FT                   /protein_id="ADR32933.1"
FT                   /translation="MRAYTPKDDVQKKPYYTDRYWVAPQVAKIDVSEDEVFAHDLEAIK
FT                   ASFDVLDAYIQVGQMVVIINAADNYGVIEMMKNELGYNQLSELSAIDWLAQEGKFEIFY
FT                   QMLSMNKRKRVRIKCKIDEKESIQSVSSLFRSADWSEREMYDMFGVVINNHPYMKRILM
FT                   PDDWEGFPLRKTYPLQGDEFAQWYEVDKLFGKEARDIIGPEIRDSARVDRYDTERFARL
FT                   GHEVPRGSDISQGEPDTPLCYQESDGVFLIEKFDAEKSVVISDRDR"
     atgagagctt acacccctaa agacgacgta cagaaaaaac cctactacac cgaccgctat        60
     tgggttgccc cgcaggtagc gaagatcgat gtaagtgaag acgaagtatt tgctcatgat       120
     ttggaagcga tcaaagcttc atttgacgta ttggatgctt atatccaagt aggacaaatg       180
     gtggtaatta tcaatgccgc tgataactac ggtgtcattg aaatgatgaa aaatgagctc       240
     gggtataacc agctctccga actaagtgca atcgattggc tggcgcaaga gggaaaattc       300
     gaaattttct atcaaatgct cagtatgaac aaacgcaaac gtgtccgtat caaatgcaaa       360
     atagacgaga aagaatcgat tcaaagtgtc tcgtctttat tccgttcggc tgattggtca       420
     gagcgtgaaa tgtacgatat gttcggtgtc gtcatcaaca accatccgta catgaaacgt       480
     attttgatgc cggacgattg ggaaggcttt ccattgcgta aaacgtatcc gcttcaaggg       540
     gatgagttcg cccaatggta cgaggtggac aaactcttcg gtaaagaggc ccgtgatatt       600
     atcgggccgg aaatccgcga cagtgcacgg gttgatagat acgataccga gcgttttgcc       660
     cgtttgggac acgaagttcc acgcggttcc gacatcagtc aaggtgaacc ggatactccg       720
     ctatgttacc aagagagcga cggtgtgttc ctcatcgaaa aatttgacgc agagaagagt       780
     gtcgtgatct ctgatcgcga ccgttaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page