(data stored in ACNUC7421 zone)

EMBL: CP002355.PE266

CP002355.PE266       Location/Qualifiers
FT   CDS_pept        254713..255939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0267"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
FT                   subunit 7; InterPro IPR010219: IPR001135; KEGG:
FT                   tdn:Suden_1826 NADH dehydrogenase subunit D; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: NADH-quinone oxidoreductase
FT                   subunit D; TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32934"
FT                   /db_xref="GOA:E4TY21"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY21"
FT                   /protein_id="ADR32934.1"
FT                   /translation="MQQSNRLRPFFENITFDRADNELILNFGPQHPSAHGQLRLMLHLQ
FT                   QEQITKAHPDIGYLHRGMEKMAENMIYNEFMPTTDRMDYIASSSNNYGFALAVERLIGL
FT                   DVPRRAKVIRMMLLETNRLMSHLFWLATTALDIGAMTVFLFAFREREYLMDLIEDYCGA
FT                   RLTHAAVRIGGVPLDLPDNFIPDLRKFLDKLPENIKDYEDLLDTNRIWKMRMENVGVIS
FT                   KEMAQSWGCSGIMLRASGVEWDIRKEEPYELYDEVDFNVPVSDKGDNYARYKLYMAEMR
FT                   ESAKILYQVLDMYEGTGPELMAHAPQYISAPKIDIMTQNYSLMQHFVLVTQGMRPPVGE
FT                   VYVATESPKGELGYFINSQGGAYPYRLKLRAPSFWHTGILTDLLPGHYIPDVVSIIGTT
FT                   NIVFGEVDR"
     atgcaacaat ccaatagatt aagacctttt ttcgaaaata ttacgtttga ccgtgccgac        60
     aatgaattga ttctcaattt cggtcctcag catccttcag ctcacggaca attgcgtttg       120
     atgctccatt tgcagcaaga gcagatcacc aaagcccatc cggatatcgg ataccttcac       180
     cgcggtatgg agaagatggc ggaaaacatg atctacaatg agttcatgcc gacaacggac       240
     cgtatggact acatcgcgtc gagttcaaat aactatgggt ttgcacttgc ggttgagaga       300
     ctgatcgggc ttgatgttcc tcgccgtgca aaagttatcc gcatgatgct cctagagact       360
     aaccgtctta tgtctcacct tttctggttg gcgactacgg cactcgatat cggtgcgatg       420
     acggtatttt tgttcgcatt ccgcgaacgc gaatatttga tggatttgat cgaagactac       480
     tgcggtgcgc gtttgaccca tgcggcagtt cgtatcggcg gtgttcctct tgatttgccg       540
     gataatttca tccctgattt gcgtaaattc ttggataaat tgccggaaaa catcaaagac       600
     tacgaagacc ttttggatac caaccgtatc tggaaaatgc gtatggaaaa cgtcggtgta       660
     atctctaaag agatggctca aagctggggc tgttcaggaa ttatgcttcg tgcatcgggt       720
     gttgaatggg atatccgcaa agaagagccg tatgagcttt atgacgaagt cgatttcaac       780
     gttccggttt ccgataaagg ggataactac gcacgttata aactttatat ggcagagatg       840
     cgtgaatcgg cgaaaatctt gtaccaagta ctcgatatgt atgaggggac tgggccggag       900
     ttgatggcgc atgcgccgca atatatctcg gctccgaaaa tcgatatcat gacccaaaac       960
     tactcgttga tgcagcattt cgtcttggta acgcaaggga tgcgtcctcc ggtaggcgaa      1020
     gtgtatgttg cgaccgaatc tccgaagggg gaacttggct atttcattaa cagccagggt      1080
     ggagcttatc cgtaccgtct aaaactccgt gcgccgtcgt tctggcacac agggattttg      1140
     accgacttac tgccgggtca ctacattccg gacgttgtat ctatcatcgg gacgactaac      1200
     atcgtcttcg gtgaagtaga ccgctaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page