(data stored in ACNUC7421 zone)

EMBL: CP002355.PE267

CP002355.PE267       Location/Qualifiers
FT   CDS_pept        255952..256176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_0142 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32935"
FT                   /db_xref="InterPro:IPR032424"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYF8"
FT                   /protein_id="ADR32935.1"
FT                   /translation="MKRYDLRHLKENFAGRMSEIIKNEAVSGEVVIFLFEIGDFSPVQQ
FT                   SADLVKELGCELMNSLKFNEADWTIVVKK"
     gtgaaacgtt acgatttacg tcatttaaaa gaaaattttg caggccgcat gtccgagatc        60
     atcaaaaatg aagcagtaag cggcgaagtt gtgattttct tgtttgagat cggtgatttt       120
     agccccgtac aacaatcggc tgatttggtt aaagagcttg ggtgcgaact catgaattcg       180
     ttgaaattca acgaagccga ctggaccatt gtggtcaaga aataa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page