(data stored in ACNUC7421 zone)

EMBL: CP002355.PE268

CP002355.PE268       Location/Qualifiers
FT   CDS_pept        256186..258222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0269"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0493 NADPH-dependent glutamate synthase
FT                   beta chain and related oxidoreductase; InterPro IPR000759:
FT                   IPR019575: IPR013027; KEGG: tdn:Suden_1824 glutamate
FT                   synthase (NADPH); PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; NADH ubiquinone
FT                   oxidoreductase, F subunit, iron sulphur binding; SPTR:
FT                   Formate dehydrogenase, beta subunit; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; NADH-ubiquinone
FT                   oxidoreductase-F iron-sulfur binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32936"
FT                   /db_xref="GOA:E4TYF9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYF9"
FT                   /protein_id="ADR32936.1"
FT                   /translation="MSKVYFSTWRGEQINNIGKNDDAWENSAYNLPLEYNEHAHSKAFI
FT                   GWDGVALFNPDVDVVRLATEYAAQYQVYSEACGRCAPGRWGGRILYDLLDKIARGEGSV
FT                   SDMEHLKEVSRTMQETSKCEIGKTVPNPLLDLMTHFESDFMDCINNQKPSKHYHLEDTS
FT                   YIAKITAPCMDACPAHVDIPAYIEGVRDLRFDDSLMATRQTMPLAHTCGRVCPHPCETE
FT                   CRRTNLDEPISIMELKRLGADYETDHGFGFFHPSEKKPSIGKKVAVIGAGPAGLTGAYY
FT                   LALDGIDVDVYEELPVLGGEVAVGVPEYRMPIDKYNQDIEAVRSLGVNFITNTKVTADM
FT                   MRQFENDYDATLVATGTRISKKVYCDNERPEIQGYWGAIDFLDKVNLQVKYDIMVPEAD
FT                   QKRHMLPTDFVDLTGKTLVCVGGGFTSMDVVRCAIRANAAKVVMLYRRDEATIIKNTTY
FT                   EEYHEAVEEGVEFIFHSAVAKMNDENDVLKSLVIDRFELVPDPNGGRPTLEKVEGASFE
FT                   MECDYLIPAVSQSADLKLLPEEWEIERTSWATIKTNGKDYMTSRKGIFAAGDCEYGPMT
FT                   IVNAVGQAKRAASVMSRYVTSGEITLTNDEIMEDHLRKLKVYNKKEKIQGWLPGLARQH
FT                   SEVLTVDERKDNNREVKYGFTQEEALAEAERCMRCYYIAMVAH"
     gtgagtaaag tctatttctc cacgtggcgg ggtgagcaaa tcaacaacat cggcaaaaat        60
     gacgatgctt gggaaaattc tgcttataac cttccgttgg aatacaatga acacgcccat       120
     tccaaagcgt ttatcggctg ggacggcgta gcgcttttta atcctgatgt cgacgtggtt       180
     cgtttggcaa cagaatacgc ggcgcagtat caggtctatt ccgaagcgtg cgggcgttgt       240
     gcaccgggac gatggggcgg acgtatttta tacgaccttc tcgataaaat cgctcgcggt       300
     gagggatcag tatcggatat ggagcatctc aaagaggttt caagaacgat gcaggaaact       360
     tctaaatgtg agatcggtaa aacggttccg aatccgcttc ttgatctgat gacccatttc       420
     gagtcggatt ttatggattg catcaacaac caaaaaccgt caaaacatta tcatttggaa       480
     gataccagct atattgccaa aatcacggcg ccgtgtatgg acgcatgtcc ggcacatgtc       540
     gacattccgg cctatatcga gggtgttcgc gatttgcgat ttgacgattc attgatggcg       600
     acccgccaaa cgatgccgct tgcgcatacg tgtggacgtg tctgtcctca tccgtgtgag       660
     acggagtgcc gacgtaccaa ccttgacgag ccgatttcga tcatggaact taaacgtctg       720
     ggtgccgatt atgagaccga tcacggtttc ggattttttc atccgagtga gaaaaagcct       780
     tcaatcggca aaaaagtagc ggttatcggt gcaggtcctg cagggcttac gggtgcgtat       840
     tatcttgcat tggacggaat cgatgtcgat gtctacgaag agcttccggt tctcggcggt       900
     gaagtagcgg tcggggttcc ggaataccgt atgccgatcg ataagtacaa tcaagatatt       960
     gaagcggtac gaagtcttgg ggtgaatttt atcaccaata cgaaagtgac cgccgatatg      1020
     atgcgtcaat tcgaaaacga ctatgatgcg acgttggtgg cgacggggac ccgtatttcg      1080
     aaaaaagtct attgtgataa tgaacgtcct gaaattcagg gttattgggg agcgatcgac      1140
     tttttggata aagtcaatct ccaagtgaaa tacgacatta tggttcctga agcggatcag      1200
     aaacgtcata tgttgcctac ggattttgtc gatttgaccg gaaaaacgct tgtatgcgtc      1260
     gggggtggat ttacctcaat ggacgtagtc cgctgcgcca tccgtgcgaa tgccgcaaaa      1320
     gtcgtcatgc tgtatcgccg tgatgaagcg acgattatca aaaatacgac gtatgaagag      1380
     tatcacgaag cggtcgaaga gggcgtagag tttatttttc actcggcggt cgcaaagatg      1440
     aacgatgaga acgatgttct caaatcactt gttattgatc gtttcgaact cgtcccggat      1500
     ccgaacggcg gtcgtccgac actcgagaaa gtcgagggtg cgagctttga gatggagtgt      1560
     gattatctga tccctgccgt atcccaaagt gctgatttga aactgctccc tgaagagtgg      1620
     gaaattgaac gtacctcttg ggcgacgatc aaaacgaacg ggaaagatta catgacctca      1680
     cgcaaaggga tctttgcggc gggagactgt gaatacggtc cgatgacgat cgttaatgcg      1740
     gtcggtcagg caaagcgtgc cgcatcggtc atgtcacgct atgtcaccag cggagaaatt      1800
     actttgacga atgatgagat tatggaagat cacctccgta aactcaaagt ctataacaaa      1860
     aaagagaaga ttcaaggttg gcttccggga ctagcgcgcc aacacagcga agttcttacg      1920
     gtcgatgaac gcaaagacaa taaccgtgag gttaaatacg ggtttaccca agaagaagca      1980
     ctcgcggaag cagaacgctg tatgcgctgt tattacattg cgatggtagc acactaa         2037
//

If you have problems or comments...

PBIL Back to PBIL home page