(data stored in ACNUC7421 zone)

EMBL: CP002355.PE269

CP002355.PE269       Location/Qualifiers
FT   CDS_pept        258233..260488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0270"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kD subunit (chain G); InterProIPR017900:
FT                   IPR019825: IPR000283: IPR001041: IPR 017896: IPR019574:
FT                   IPR006963; KEGG: tdn:Suden_1823 NADH dehydrogenase subunit
FT                   G; PFAM: NADH:ubiquinone oxidoreductase, subunit G,
FT                   iron-sulphur binding; ferredoxin; molybdopterin
FT                   oxidoreductase Fe4S4 region; SPTR: Ferredoxin; PFAM:
FT                   Molybdopterin oxidoreductase; NADH-ubiquinone
FT                   oxidoreductase-G iron-sulfur binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32937"
FT                   /db_xref="GOA:E4TYG0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG0"
FT                   /protein_id="ADR32937.1"
FT                   /translation="MINFTINGQPVIANKGETILQAARKAGFYIPTMCYLEKTTPCASC
FT                   RLCVVETDKTDGLILSCQTPPTEGLAVVIDSDRLKTERTNIMRLYDVNHPLECGVCDKS
FT                   GACDLQNKTLEFGVSSQHFSAKDQHRKIEHWGLINYDPSLCILCEKCVHVCNEIIGDDA
FT                   IELQFGGYKSSVIPKNSDALDCTFCGECIAVCPVGALVSSNFQYSANAWELSQIPATCV
FT                   HCSAGCSLMYEVRHTSNLTGAKDKIYRVTNDFEHTTLCGAGRFGFDFNVEGTKDEAQFA
FT                   KAVDAIKNADAIRFSSLITNEEAMILQSLKEKLGLKLYNEEARAYQNFMNAYASISGKT
FT                   GFGGSLDAIKQSDGIIVFGGRVTTDNPMVRYAMTTAARHNGAKVVYMHPIEDDLLQNVV
FT                   TQYVKYEVGTEEGVVAMLAKTLLENADVSDETRHFFEGLDEGYLCAESNIGDEEYARMA
FT                   KTFARAKRKTLVIGSDVLTHKRAANISRLCAMIETYTEFSVVVIAPSVNTIGVSLICDL
FT                   DADNNGENVVGYNAAGSYTMGSFDEAMLKLPSLNSQEGTFVSINHQVLPTNVAVAFDGY
FT                   TLNDLANALGLSAHNTIDYTAQLPESKGFNGSSFDDLGNFYSALGEDNRGYVLENRDVE
FT                   ADGKLEEIDDLPEFNGTVVYRCNPVNQFNTYTARTEQLEKEAILRGSAQFAAAAKIGDG
FT                   DKIRIEFPHSTQERIFKLDSAMKGTIALVPAYDVGFGGLNEQYRFEKVKIMRMGSES"
     atgatcaatt ttacgattaa cggccagccc gtcatagcaa acaaagggga gacgattctc        60
     caagcggcac ggaaagcggg attctatatc ccgacgatgt gttatttgga aaaaacgact       120
     ccgtgtgcat catgccgatt atgtgtggta gagaccgaca aaacggacgg cttgattctc       180
     agctgccaaa ctccgccgac cgaagggttg gcggtagtga tcgattcgga tcgtctcaag       240
     actgagcgaa cgaacattat gcgtctttac gatgttaatc atccgttaga gtgcggtgtg       300
     tgcgataaat cgggtgcatg cgacctacaa aacaaaacgt tggagttcgg tgtctcttct       360
     cagcatttca gtgcaaaaga tcagcatcgt aaaatcgagc actggggact gatcaactac       420
     gatccgtctc tttgtatttt gtgtgaaaaa tgtgtccatg tctgtaacga aatcatcggt       480
     gatgacgcga tcgaattgca attcggcggg tacaaatcat cggttattcc gaaaaacagc       540
     gatgcactcg attgtacgtt ctgcggcgaa tgtatcgcgg tatgtcctgt gggtgcgttg       600
     gtaagctcaa actttcagta cagtgccaat gcatgggaac ttagccagat ccctgcaacc       660
     tgtgttcatt gttcggcagg atgttcattg atgtacgaag tgcgccacac gtcaaacttg       720
     acaggcgcca aagataaaat ctaccgtgtc acaaatgatt tcgagcatac gacactgtgc       780
     ggagcgggac gattcggatt cgatttcaac gtagagggaa ccaaagacga agcacaattc       840
     gctaaagcgg ttgatgcgat caaaaatgcg gacgctatcc gttttagttc attgatcacc       900
     aatgaagagg cgatgatcct tcaaagcctc aaagagaaat tgggtctaaa actttacaat       960
     gaagaggcgc gtgcgtatca aaactttatg aacgcatatg catcgatcag tggaaaaacc      1020
     ggtttcggcg gaagtttgga tgcgattaaa caaagcgacg gtatcatcgt tttcggcggg      1080
     cgtgtaacga ccgacaatcc tatggttcgt tatgcaatga cgacggctgc ccgccataac      1140
     ggtgcgaaag tcgtctatat gcatccgatc gaagacgatc ttcttcaaaa tgtcgtgacg      1200
     cagtacgtca aatacgaagt gggtaccgaa gagggtgttg ttgcgatgct tgcaaaaacg      1260
     cttctggaaa atgcggatgt aagcgatgaa acacgccatt ttttcgaagg tcttgacgaa      1320
     gggtatctat gcgccgagag taatatcggt gatgaagagt atgcccgtat ggccaaaacg      1380
     tttgcgagag ccaaacgcaa aacattggtg atcggaagcg acgtcctcac tcataaacgc      1440
     gcagcgaata tttcccgttt gtgcgcaatg atcgaaacct atacggagtt ttcggttgtt      1500
     gtaatcgcac cgagtgtcaa tacgatcggt gtttcattga tctgtgatct ggatgctgac      1560
     aacaacggcg aaaatgttgt cggatacaat gcggcgggtt cgtataccat gggctcattt      1620
     gatgaagcga tgttgaaatt gccgtctctt aactctcagg aggggacatt cgtcagtatc      1680
     aatcaccaag tgcttccgac caatgttgca gtcgcattcg atgggtatac gttaaacgat      1740
     ttggcaaatg ctcttggact atcggctcac aatacgatcg actataccgc acagcttccg      1800
     gaatcaaaag ggtttaacgg atcatcgttt gatgatttgg ggaattttta cagtgcattg      1860
     ggcgaagata accgcgggta tgtcctagaa aatcgcgatg tagaagctga cgggaaacta      1920
     gaagagattg atgatttacc tgagttcaac ggtacggtcg tataccgctg caacccggtc      1980
     aatcagttta atacctacac ggctcgaacc gaacagctcg aaaaagaggc aatattgcgc      2040
     ggttcggcac agtttgccgc tgccgcaaaa atcggtgatg gtgataaaat tcgcattgaa      2100
     tttcctcaca gcacccaaga gcggattttt aaactcgatt ctgcgatgaa agggaccatt      2160
     gcattggttc cggcatacga tgtcggattc ggcggtttaa atgagcaata ccgttttgaa      2220
     aaggtgaaaa ttatgaggat ggggagcgaa tcatga                                2256
//

If you have problems or comments...

PBIL Back to PBIL home page