(data stored in ACNUC7421 zone)

EMBL: CP002355.PE27

CP002355.PE27        Location/Qualifiers
FT   CDS_pept        complement(28746..29807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0027"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /note="COGs: COG2038 NaMN:DMB phosphoribosyltransferase;
FT                   InterPro IPR002805: IPR003200; KEGG: ant:Arnit_1840
FT                   hypothetical protein; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Phosphoribosyltransferase; TIGRFAM:
FT                   conserved hypothetical protein TIGR00303"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32695"
FT                   /db_xref="GOA:E4TW79"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW79"
FT                   /protein_id="ADR32695.1"
FT                   /translation="MIKTITGNKDFIESLRGKRASFLLCMSNTKTANIEGITQAGIPGM
FT                   LHLTPTLDAEFIAIGEVRSLGSIAETPKGVPTPALLTRAVHLLHPFREIEMLELGLEIS
FT                   PKLEHFKLHSFGIAPSDSISDGANIPAEEVFEKGIQFAQNLTIQSDYIILGESVPAGTT
FT                   TALATALALGYDAQDKFSSSFKNAPSGIKQSVVDQALSRIGENDDLFSILSKVGDNMLI
FT                   FNAGLILGLQNRDIRIVLAGGTQMACALLVVNRILQMMEGELDTSRIALCTTKWVAEDT
FT                   QSDIKALLEMNDFALNAYYADFDFSLTDHPALKLYDEGEAKEGVGAGGALMYGLLNGLS
FT                   KEAITRKVESFLG"
     atgatcaaaa cgattaccgg aaacaaagat ttcatcgaga gtctgcgggg gaaacgggcc        60
     agttttcttc tgtgcatgag caacaccaag acggcaaaca tcgaggggat tacccaggcg       120
     ggaatccccg gaatgctcca cctcaccccg acgctcgatg cggagtttat cgcgatcgga       180
     gaggtgcgca gtctcggctc catcgccgaa acccccaaag gggtccccac ccccgccctc       240
     ctcacccgcg ccgtccatct cctccatccg ttccgtgaaa tagagatgct ggaactgggg       300
     ctggagattt ccccgaaact ggagcatttc aagcttcact cattcggcat tgcccccagc       360
     gattcgattt ctgatggggc gaacatcccc gccgaagagg tgtttgaaaa agggattcag       420
     ttcgcccaga atctcaccat ccaaagcgat tacatcattt taggcgaatc ggttcccgcc       480
     ggaacgacga cagcgctcgc cacggcgctg gctttggggt acgatgcgca ggataaattc       540
     agcagcagtt tcaaaaacgc cccaagcggc atcaaacaaa gcgtcgtcga tcaagccctc       600
     tcccgcatcg gcgagaatga cgatctcttt agtatcctct ctaaagtggg ggacaacatg       660
     ctgatattca acgccggatt gatcctcggt ctccaaaacc gcgatatcag aatcgtcctc       720
     gcagggggga cgcagatggc gtgtgctctt ctcgtcgtca accgcatttt gcagatgatg       780
     gagggggaac tggacacctc tcgcatcgcc ctttgcacga ccaaatgggt cgccgaagat       840
     acgcagagcg atatcaaagc cctcttggag atgaacgatt tcgccctcaa cgcctattac       900
     gccgatttcg atttctccct caccgatcat cccgccctca aactctatga cgagggggag       960
     gcgaaagagg gggtcggtgc cggaggcgcg ctaatgtacg gcttgctcaa cggtctgagt      1020
     aaagaggcga tcacccgcaa agtggagagc tttttaggat ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page