(data stored in ACNUC7421 zone)

EMBL: CP002355.PE270

CP002355.PE270       Location/Qualifiers
FT   CDS_pept        260485..262971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0271"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kD subunit (chain G); InterProIPR017900:
FT                   IPR006655: IPR001041: IPR017896: IPR 019574: IPR006963;
FT                   KEGG: tdn:Suden_1822 NADH dehydrogenase subunit G; PFAM:
FT                   NADH:ubiquinone oxidoreductase, subunit G, iron-sulphur
FT                   binding; ferredoxin; molybdopterin oxidoreductase Fe4S4
FT                   region; SPTR: Ferredoxin; PFAM: NADH-ubiquinone
FT                   oxidoreductase-G iron-sulfur binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32938"
FT                   /db_xref="GOA:E4TYG1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG1"
FT                   /protein_id="ADR32938.1"
FT                   /translation="MNEITITIDGRTVQTQEGEYILNAARANGIFIPAICYLTRCSPTL
FT                   ACRICLVEADGKQVYACNAKAKEGMEITTTTPNILEERRAIMEVYDVNHPLECGVCDQS
FT                   GECELQNYTLEVGVDSQNYAIKDTHKPAQDWGLIHYDPALCIMCERCITVCKDMIGDAA
FT                   LSTVARGSDAIHGEYKAMMPKDAYAMWNKLNKSLIAPNGGDTLDCTNCGECTSVCPVGA
FT                   LVSSDYQYTSNAWEHKQIPATCAHCSAGCQLSYDIKHTSISNPESKIYRVKNEWNYVSL
FT                   CGAGRYGYDFENRDVSKDKAAFDKAIEAFKKADTIAFTSTITNEEAMILQRLKEKYGYR
FT                   LVNSEALALKNFLGSYSAISKTSLYGGDLKQVHEADFVVSIGSALKTDNPNARFAMNNA
FT                   LSMNKGSGLYFHPINDPVIQDMSKNITQFNHAPMMEEAALYLMLDLFGDKAAMPSAVTE
FT                   YLAGFHSTKTVTIEESVDEKVTETVTKKVLNEETGVEEEVSEEVTKTIKKKVSKEVEVD
FT                   DNALFGLLNAPEKFAETLEKYLAKKEKFALMVGPDLYTHPNAANCARLVALIEKYTPFS
FT                   VTMIPNLANTLGAALICDLDSSRGSYTIGYNTRGDFTLSALGNGDLDMPALNQQEGTLT
FT                   GIDKRVNPTNAALGYGGYVLNDIANALGITAKYTVDYTAQLPVKNGFKALSFDTLPNYY
FT                   TNAGEEVRGYVLENIAVNSGGDESVQPLNPNAAIRENVVYLANPVLQFSAFTAASHQLN
FT                   AKGGLYASHTAMQTNGWSEGDALRVKTAHGELSVNVIADGKIGGDITYLPTFDTAINSE
FT                   ALFDGYRFACVSIQKV"
     atgaacgaaa tcacgattac catagacggc cgcactgtcc agacgcaaga gggtgaatat        60
     atccttaatg cggcacgggc aaacgggata tttatcccgg cgatctgtta tttgacacga       120
     tgttcgccga cactggcatg tcgtatttgt ttggtcgaag cagacggcaa acaggtctat       180
     gcgtgtaatg caaaagcaaa agaggggatg gagattacga caacgactcc gaatatcctc       240
     gaagaacgca gagcgattat ggaagtttac gacgtaaacc atcctctaga gtgcggtgtc       300
     tgtgaccagt caggtgaatg cgaacttcaa aattacacct tagaagtcgg cgtagactca       360
     caaaactatg cgattaaaga tacccacaaa ccggcgcagg attggggatt gattcactac       420
     gatccggcac tgtgtatcat gtgtgaacgt tgtattaccg tatgtaaaga tatgatcggt       480
     gatgcggctc tcagcacggt tgcgcgcggc agtgatgcga ttcacggcga atacaaagcg       540
     atgatgccga aagacgccta tgcgatgtgg aacaaactta acaaatcgct gatcgctcca       600
     aacggcgggg acacactcga ttgtaccaac tgcggtgaat gtacgtcggt atgtccggtc       660
     ggtgcgttgg tgagcagtga ttatcaatac acttccaatg catgggagca caaacaaatc       720
     cctgcaacgt gtgcccactg ttctgcggga tgtcagctca gctacgatat caaacacacc       780
     agtatcagca atccggaatc taaaatctac cgtgtcaaaa acgagtggaa ctatgtatca       840
     ctgtgcggtg caggacgcta cgggtacgat ttcgaaaatc gtgatgtgag caaagacaaa       900
     gcggcattcg ataaagcgat cgaagcgttt aaaaaagccg atacgattgc ctttacctct       960
     accattacca acgaagaagc aatgattctt caacgtctca aagagaaata cggatatcgc      1020
     ctggtgaaca gcgaagcatt ggcgttgaaa aactttttgg gcagttacag tgcaatcagt      1080
     aagacatcac tttacggcgg cgatttgaaa caggttcatg aagccgactt cgtcgtatcc      1140
     atcggaagtg ctcttaaaac cgataacccg aatgcacgtt ttgcgatgaa caatgcactg      1200
     agcatgaata aaggctcagg gctttatttc catccgatca acgatccggt gattcaagat      1260
     atgtctaaaa acattaccca gttcaatcac gctccgatga tggaagaggc ggcattgtat      1320
     ttgatgctgg atcttttcgg tgacaaagcg gcaatgccgt cagccgttac ggagtatttg      1380
     gcagggttcc attcgaccaa aaccgtaacg atcgaagaga gcgttgatga aaaagtgact      1440
     gaaacggtaa cgaaaaaagt gcttaacgaa gagaccggtg ttgaggaaga ggtaagcgaa      1500
     gaagttacca aaacaatcaa gaaaaaagtt tccaaagagg ttgaagtcga tgacaatgcc      1560
     cttttcgggc ttttgaacgc gccggaaaaa ttcgctgaga ccttggaaaa atatttggcg      1620
     aaaaaagaaa aattcgccct tatggtcgga ccggatcttt atacccatcc gaatgcggca      1680
     aactgcgccc gtctcgtcgc attgatcgaa aaatacactc cgttcagtgt tacaatgatt      1740
     ccgaatcttg caaatacatt gggtgcggcg ttgatttgtg atctggattc gtcgcgcgga      1800
     agctatacca tcggctataa cacacgcggt gatttcaccc ttagcgcatt agggaacggc      1860
     gatttggata tgccggctct gaaccagcag gaagggacat tgaccggcat cgacaagcgg      1920
     gttaatccga ccaatgcggc actcggctac ggcggatacg tactcaatga tatcgccaat      1980
     gcattgggca taactgcgaa gtataccgtt gattatacgg cacagcttcc ggtgaaaaac      2040
     ggatttaaag cactctcttt tgatacattg ccgaactatt acaccaatgc cggtgaagaa      2100
     gtccgcgggt atgtattgga aaacattgcc gtaaacagcg ggggcgatga gagtgttcaa      2160
     ccgttgaatc caaatgcggc cattcgtgag aatgtggtct atttggcaaa tccggtgttg      2220
     cagttttccg cgtttacggc agcatcgcat caacttaacg caaaaggtgg tttatacgct      2280
     tcgcatacgg cgatgcagac gaacggctgg agcgaagggg atgcattgcg tgttaaaaca      2340
     gcacatggcg agctgagtgt caatgtaata gctgacggta agatcggagg agatattaca      2400
     tatctcccga cattcgatac cgctatcaac tctgaagcac tgtttgacgg ttaccgtttt      2460
     gcgtgcgtat caattcaaaa ggtgtaa                                          2487
//

If you have problems or comments...

PBIL Back to PBIL home page