(data stored in ACNUC7421 zone)

EMBL: CP002355.PE271

CP002355.PE271       Location/Qualifiers
FT   CDS_pept        262975..263964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0272"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1005 NADH:ubiquinone oxidoreductase subunit
FT                   1 (chain H); InterPro IPR018086: IPR001694; KEGG:
FT                   tdn:Suden_1821 NADH dehydrogenase subunit H; PFAM:
FT                   respiratory-chain NADH dehydrogenase subunit 1; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: NADH-quinone oxidoreductase
FT                   subunit h; PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32939"
FT                   /db_xref="GOA:E4TYG2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG2"
FT                   /protein_id="ADR32939.1"
FT                   /translation="MDVAFIIETIVKIVVILLIFSALAGLGTYFERKVLAFMQRRLGPM
FT                   HVGPFGLLQVAADGIKLFTKEDIIPQNVVKPIFKIAPVITAATAFMASAAIPFWPQFTV
FT                   FGYTVHPIVADINVGILYVLGVMAIGLYGPLLGGMASANKWSLISAARSAAIFISYEVI
FT                   SGLSLLAPLMMVGSLSLIDINNYQAGGIGNWIVWSQPVAFILFWIAAFAETGRTPFHLV
FT                   ANDHEIIDGFGTEYSGMRWGMFFIGEYANMFFISFVIAIIFLGGFGDGTIAGAIQLLLK
FT                   VAFFFFFFLWTRAAWPDIRPDQLMWLCWKVLMPIAVINIVVTGIVMMF"
     atggatgtag cattcattat agaaacgatc gttaaaatcg ttgtcatctt attaattttc        60
     tctgcgcttg cgggtcttgg aacctatttc gagcgtaaag tgctggcgtt tatgcaacgc       120
     cgtttgggac cgatgcacgt cgggccgttc ggtttgcttc aagttgcggc ggacgggatt       180
     aaactcttta ccaaagagga catcatcccg caaaacgtag ttaagccgat ttttaaaatt       240
     gctccggtca ttacggcggc aacggcgttt atggcttctg cggcaatccc gttttggcca       300
     caatttacgg tattcggata cacagtgcat ccgatcgttg ccgatatcaa tgtcggtatc       360
     ctctacgtac taggggttat ggcaatcggt ttgtacgggc cgttgctcgg ggggatggca       420
     tcggcgaaca aatggtcact gatctcggct gcacgtagtg ccgccatctt catctcgtat       480
     gaagttattt cagggctttc actgttggcg ccgcttatga tggtcgggtc attgtcgttg       540
     atcgatatca acaactatca agccggcgga atcggaaact ggatcgtctg gtcgcagcct       600
     gtggcattta tccttttttg gattgctgca tttgccgaaa ccggacgtac tccgtttcac       660
     ctcgttgcga acgatcacga gatcattgac ggtttcggta cggagtattc gggtatgcgc       720
     tgggggatgt tcttcatcgg tgaatatgcg aatatgttct ttatttcgtt tgtaatcgcc       780
     atcatctttt tgggcggttt tggcgacggt acgattgcgg gagccattca gttgcttctc       840
     aaagtagcgt ttttcttttt ctttttcctc tggacacgtg cagcatggcc ggatatccga       900
     cctgaccagt tgatgtggtt gtgctggaaa gttttaatgc cgattgcggt gatcaacatt       960
     gttgtcaccg gtatcgtgat gatgttctaa                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page