(data stored in ACNUC7421 zone)

EMBL: CP002355.PE272

CP002355.PE272       Location/Qualifiers
FT   CDS_pept        263977..264600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0273"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
FT                   InterPro IPR017900: IPR010226: IPR017896; KEGG:
FT                   tdn:Suden_1820 NADH dehydrogenase subunit I; SPTR:
FT                   NADH-quinone oxidoreductase subunit I; TIGRFAM:
FT                   NADH-quinone oxidoreductase, chain I; PFAM: 4Fe-4S binding
FT                   domain; TIGRFAM: NADH-quinone oxidoreductase, chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32940"
FT                   /db_xref="GOA:E4TYG3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG3"
FT                   /protein_id="ADR32940.1"
FT                   /translation="MHHEEVFTDRNVSEHSAYYYVDIEAYPESGWDKFKQVLKRALRGE
FT                   LFVGLWVVLREMIKFDIHTVQYPKEKLPIGPRYRAVHKLLRLWESGYERCIGCGLCEKI
FT                   CISDCIRMDTRIDENSRKEVTEYSINLGRCIFCGYCAEVCPELAIVHGQRYENASEQRA
FT                   HFVIKDDMLTPLDLLKAGEQAEYPGFGAIIPGSDASVKKTPLAY"
     atgcatcatg aagaagtatt tacagatcga aatgtaagtg aacacagcgc ttattattac        60
     gtcgatattg aagcctatcc ggaaagcgga tgggacaagt ttaaacaagt gctcaaacgt       120
     gcgttgcgcg gcgagctctt tgtagggctg tgggtcgtat tgcgcgagat gatcaaattt       180
     gatatccata ccgttcaata tccgaaagaa aaactgccga tcgggccacg ttatcgtgca       240
     gtacacaaac ttttgcgttt gtgggagtcg gggtatgagc gctgtatcgg atgcggattg       300
     tgcgaaaaaa tctgtatttc cgattgtatc cgtatggata cgcgcatcga tgagaacagc       360
     cgtaaagaag taaccgagta cagtatcaac ctcgggcgtt gtattttctg cggttattgt       420
     gccgaagtgt gtcctgagct tgcaatcgtt cacggacaac gttatgaaaa tgcgtcggaa       480
     caacgggccc atttcgtgat caaagacgat atgctcaccc cgcttgattt gcttaaagca       540
     ggcgaacagg cggaataccc aggctttggt gccattatcc caggaagcga cgcgtcggtc       600
     aaaaagaccc cgctggcgta ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page