(data stored in ACNUC7421 zone)

EMBL: CP002355.PE273

CP002355.PE273       Location/Qualifiers
FT   CDS_pept        264610..265197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0274"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0839 NADH:ubiquinone oxidoreductase subunit
FT                   6 (chain J); InterPro IPR001457; KEGG: tdn:Suden_1819 NADH
FT                   dehydrogenase subunit J; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6; SPTR:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 6;
FT                   PFAM: NADH-ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32941"
FT                   /db_xref="GOA:E4TYG4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG4"
FT                   /protein_id="ADR32941.1"
FT                   /translation="MFEAIAFYLFAALTIVMFTITVMTSQALYAITAMAAGMIFISAFF
FT                   FILGADFLGAIQIIVYTGAVMALYAFGMMFFDTTRDVVEKRTNPQIVFVLGVLAAVMVV
FT                   AIFVAPIVSNNIQALYPIQENIGNSQAVGMVLFTKYLVPFEVAAVMLLVAMIGGIILAG
FT                   KKMDKSLTLMAEEEISTMDDMTEEEVQAGGHH"
     atgtttgaag ctatcgcttt ttatctgttt gcagccctca ccattgtgat gtttaccatc        60
     accgtgatga cgtctcaagc actgtatgct atcaccgcaa tggcggctgg gatgattttt       120
     atttcggcat ttttctttat tttgggtgcc gactttttag gtgcaatcca aattatcgtt       180
     tataccggag ccgttatggc gctctatgcg ttcgggatga tgtttttcga tacgacccgc       240
     gacgtagttg aaaaacggac taacccgcaa atcgtttttg tcctaggcgt tttagcggcg       300
     gtcatggtcg ttgctatttt cgtcgcaccg atcgtttcga ataatattca agcactttat       360
     ccgatccaag agaatatcgg aaactctcaa gccgtcggta tggttttgtt taccaaatac       420
     ctcgttccgt ttgaagtcgc ggcggtcatg ctgcttgtcg caatgatcgg cggaattatt       480
     ttggcaggga agaaaatgga caaatcgttg acattgatgg cggaagaaga gatcagcaca       540
     atggatgata tgaccgaaga agaagtacaa gcaggggggc accactga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page