(data stored in ACNUC7421 zone)

EMBL: CP002355.PE274

CP002355.PE274       Location/Qualifiers
FT   CDS_pept        265197..265502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0275"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0713 NADH:ubiquinone oxidoreductase subunit
FT                   11 or 4L (chain K); InterPro IPR001133; KEGG:
FT                   tdn:Suden_1818 NADH dehydrogenase subunit K; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 4L; SPTR: NADH-quinone
FT                   oxidoreductase chain 11; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32942"
FT                   /db_xref="GOA:E4TYG5"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG5"
FT                   /protein_id="ADR32942.1"
FT                   /translation="MEVTLSHYLVLSSILFSIGLIGVMRRKNLLMLFFATEILLNATNI
FT                   AFAAISHYIGDLSGQMFAFFIIAIAASEVAIGLGLLIVWYKRTGKIDLDQMNSMRG"
     atggaagtta cactgagcca ttatcttgtt ttatcaagca tattgttctc gatcggtttg        60
     atcggggtta tgcgccgcaa aaatcttttg atgctctttt ttgcaacaga gattttgcta       120
     aatgcaacca atatcgcatt cgctgctatt tctcattata tcggggattt gagcggtcaa       180
     atgtttgcgt tctttattat cgcgattgcg gcatctgaag tggcaatcgg attgggtctt       240
     ctcatcgtat ggtacaaacg taccggtaag atcgacctag atcaaatgaa ttcaatgcga       300
     ggataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page