(data stored in ACNUC7421 zone)

EMBL: CP002355.PE275

CP002355.PE275       Location/Qualifiers
FT   CDS_pept        265506..267392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0276"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1009 NADH:ubiquinone oxidoreductase subunit
FT                   5 (chain L)/Multisubunit Na+/H+ antiporter MnhA subunit;
FT                   InterProIPR003945: IPR003916: IPR018393: IPR001516: IPR
FT                   001750: IPR010934; KEGG: tdn:Suden_1817 NADH dehydrogenase
FT                   subunit L; PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein; NADH dehydrogenase subunit 5 domain protein; SPTR:
FT                   NADH-plastoquinone oxidoreductase, chain 5; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; NADH-Ubiquinone oxidoreductase (complex I), chain 5
FT                   N-terminus; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32943"
FT                   /db_xref="GOA:E4TYG6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG6"
FT                   /protein_id="ADR32943.1"
FT                   /translation="MELYLYIALFAPLVGSLFSALFTATPKSSITGYVASGLLFTSFVS
FT                   SAILLNYVMGGHTVHVEMMTWMATGDLYIPFGFVVDQVSVVMMMVVTIVSTVVHVYSIG
FT                   YMDHDKGFNRFFAWLSAFVFSMMVLVMSDNFAGLFIGWEGVGLCSWGLIGFWYHKESAT
FT                   WAANEAFIMNRIADLGMLIGIFLIYWNVGSLQYDVVFAEVGNLQPVIITWIGIFLFIGA
FT                   MGKSAQFPLHTWLADAMEGPTPVSALIHAATMVTAGVYLVVRANPIYDLIPNVGIFIAS
FT                   LGAFVALFAASMALVNRDMKRIIAYSTLSQLGYMFVAAGLGAYWVALFHLMAHAFFKAL
FT                   LFLGAGNVMHAMHDELDPFKMGGLRKVMKGTFVMMTLASVALAGIYPFAGFFSKDLILE
FT                   VGFVEHHYVIYTVLLLTAGLTAFYSFRLVALIFHGEERYKLFGIHPHEAYKFMLVAMSP
FT                   LLVLAIIAGSFKMTYYQLVINLLPSTQYHVHSATTFWIMTIGTQLFVILAILFAYKKYS
FT                   NWNSVPDGTSKMEKSFGYKLLWNQYYIPKIYDEVFSKPYLELSKIAWKQIDLKIVDATV
FT                   DAIANAIYKTGENTRDIQNGNLSSMLRWMVVGLVVLMTLAVAFNVGYNVFGA"
     atggaacttt atttatatat tgcactcttc gctccgttgg tcggatcatt gttttcggca        60
     ttgttcacag cgacaccaaa atcaagcatt acggggtacg tagcctcagg tctgttattt       120
     acgtcgtttg taagcagtgc tattttgctc aattatgtca tgggaggcca taccgtacac       180
     gttgagatga tgacgtggat ggcgacgggt gatttgtata tcccgttcgg atttgttgtt       240
     gatcaggtaa gcgtggtcat gatgatggtt gttacgatcg tttcaaccgt tgtacacgtt       300
     tattccatcg gatatatgga ccacgacaaa gggtttaacc gtttctttgc atggctttcg       360
     gcattcgtat tctcgatgat ggtactcgtt atgagtgaca atttcgcagg tcttttcatc       420
     ggatgggaag gggtcggtct ttgttcatgg gggctcatcg gattctggta tcacaaagaa       480
     tcggcaacat gggcggcaaa cgaagcgttc attatgaacc gtatcgccga ccttgggatg       540
     ttgatcggta ttttcttgat ttactggaac gtcggttcat tgcagtacga tgtcgtattt       600
     gccgaagtcg gtaatcttca gccggtaatt attacgtgga tcggtatttt cctattcatc       660
     ggtgctatgg gtaaatcggc acagtttccg ttacacacat ggcttgccga tgcgatggaa       720
     ggtccgactc cggtttccgc gctgatccat gccgcaacca tggttaccgc aggggtatac       780
     cttgttgtcc gtgcaaatcc gatttacgat ctgattccga acgtcggtat ctttatcgcg       840
     agcctcggtg cattcgttgc cctttttgcg gcatcgatgg cattggttaa ccgtgatatg       900
     aaacgtatca ttgcgtattc tacattgtca caactcggct atatgttcgt agcagccgga       960
     ttgggagcgt attgggttgc attgttccac cttatggcac acgcattttt caaagcgctc      1020
     ttgttcctcg gtgccggtaa cgtcatgcac gcaatgcacg atgagcttga cccgttcaaa      1080
     atggggggat tgcgcaaagt gatgaaaggg acattcgtta tgatgaccct cgcttcggtt      1140
     gcgttagcgg gtatctatcc gttcgccgga ttcttctcaa aagatttgat tttagaagtc      1200
     gggtttgttg agcatcatta tgttatttat acggtattgt tgttgacggc agggttgacc      1260
     gcattttatt cattccgtct tgtcgcgttg atcttccacg gggaagagcg ctataaactt      1320
     ttcggtatcc atcctcatga ggcgtataaa tttatgttgg tggcgatgtc gccgttgctt      1380
     gtactggcaa ttattgcagg ttcgtttaaa atgacctact accaattggt gatcaatctt      1440
     cttccatcga cgcagtacca tgttcacagc gcaacgacgt tttggattat gacgatcgga      1500
     acgcagctgt ttgttatcct tgccattctt tttgcgtaca aaaaatacag caactggaac      1560
     agtgtaccgg atggaacgtc taaaatggaa aaaagctttg gctacaaatt gttgtggaat      1620
     caatattaca ttccaaaaat ctatgacgag gttttttcga agccgtatct tgaactttct      1680
     aaaatcgcat ggaaacagat cgatcttaaa atcgtcgatg caaccgtcga tgcgattgcc      1740
     aatgcaattt acaaaacggg tgagaataca cgcgatatcc aaaacggaaa tctttcatct      1800
     atgcttcgtt ggatggttgt cggtttggtt gtactaatga cactagccgt tgcctttaac      1860
     gttgggtaca acgtgtttgg cgcttaa                                          1887
//

If you have problems or comments...

PBIL Back to PBIL home page