(data stored in ACNUC7421 zone)

EMBL: CP002355.PE276

CP002355.PE276       Location/Qualifiers
FT   CDS_pept        267402..268949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0277"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1008 NADH:ubiquinone oxidoreductase subunit
FT                   4 (chain M); InterPro IPR010227: IPR003918: IPR001750;
FT                   KEGG: tdn:Suden_1816 NADH dehydrogenase subunit M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   Donor-ubiquinone reductase I; TIGRFAM: proton-translocating
FT                   NADH-quinone oxidoreductase, chain M; PFAM:
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32944"
FT                   /db_xref="GOA:E4TYG7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG7"
FT                   /protein_id="ADR32944.1"
FT                   /translation="MIDHILTLLIFFPALAAMLGFVVTKDSMRAYGIAVAFIEFVLSLW
FT                   LWYAYDPMISGMQFMESMPLIPAFGINYLLGVDGISLFIIILSTFFTLIGIASLTEKRR
FT                   IKDLIITLLFLEMTMVGVFAALDAIVFYVFWELSLVPMLYIIGAWGGPLRIYASIKFFL
FT                   YTFTGSLVMLVGMLFMAYFYYQATGQWSFSILEWYRLILPENFQLWLFAAFFLGFAIKV
FT                   PMFPFHTWLPYAHGQAPTIGSVILAAILLKMGTYAFVRFSLPLFPDASVFFMFPIAIIA
FT                   IIMIIYTAMVAYAQEDIKQVVAYSSVSHMGVIILGTFALNVEGVSGSVFLMLAHGVVSG
FT                   ALFLLVGVIYDRRHTKLMSEFGGLASVMPRYATIFGIMMMASVGLPLTINFVGEFLSLL
FT                   GFYKQSHMLTLTAGVAIIVGAIYMLSAYKKAFFGPVTNEANRHLKDVNRTELLGLIPLV
FT                   IVAIWLGVYPKPVLEPINNSVESVIQLMHDKAQSPEAKERIPDLSGKNGIISMKEAN"
     atgatagatc atattttaac acttttaatt ttcttccctg cattggcagc aatgcttgga        60
     tttgtcgtca caaaagatag tatgagagcc tacggtatcg ccgtagcatt catcgagttt       120
     gtcctctctt tgtggttgtg gtatgcatac gatccgatga tttcgggaat gcagtttatg       180
     gagtctatgc cgttgattcc ggcgtttggt attaattacc ttctcggtgt tgatggaatt       240
     tcgctcttta tcatcattct ttcaacgttt ttcacgttga tcggcatcgc gtcattgacc       300
     gaaaaacgcc gtataaaaga tttgattatc acgttgttgt tccttgagat gacaatggtg       360
     ggtgtttttg cggctttgga tgcgattgtc ttttacgtat tctgggaact ctctttggtt       420
     ccgatgctct acatcatcgg tgcatggggc ggaccgctac gtatttatgc gtcgatcaag       480
     tttttcctct acacctttac agggtcgttg gtgatgttgg tcggtatgct gtttatggcc       540
     tatttttatt accaagcgac cggtcaatgg agcttctcga tccttgaatg gtaccgtttg       600
     attttgccgg aaaacttcca attgtggctg tttgcggcat ttttcctcgg ttttgcgatc       660
     aaagttccga tgttcccgtt tcatacatgg cttccgtatg cgcacggtca ggcaccgacc       720
     atcggttcgg ttatccttgc ggcaattttg cttaaaatgg gaacctatgc gtttgtccgt       780
     ttctctttgc cgttgttccc ggatgcatcg gtatttttca tgttccctat cgcaatcatt       840
     gcgatcatca tgattattta tacggcgatg gtagcgtatg cgcaagaaga tattaaacaa       900
     gtcgttgcgt acagttcggt atcccacatg ggggttatta tcctcggaac tttcgcattg       960
     aacgttgagg gggtgagcgg atcggtattc ttgatgctcg ctcacggggt cgtttccggt      1020
     gctctgttct tgcttgtggg tgttatctac gatcgtcgcc atacaaaact gatgtcagag      1080
     ttcggtggtc ttgcatccgt aatgccgcgt tatgcgacta ttttcggaat tatgatgatg      1140
     gcatcggtcg gattgccgct tacgatcaac ttcgtcgggg agtttttaag tcttttaggc      1200
     ttttacaaac aatctcatat gttgacgttg acggctgggg tagcgattat cgtcggtgcg      1260
     atctatatgc tttcagcgta taaaaaagcc tttttcggcc ctgtaacgaa tgaagctaac      1320
     cgccatctaa aagatgtcaa tcgtacagag cttttaggat tgattccttt ggttatcgtc      1380
     gctatctggc taggggttta tccgaaaccg gttttagagc cgattaataa cagtgttgaa      1440
     tcggtgattc agcttatgca cgataaagcg caaagtcctg aagcgaaaga gcgcatccct      1500
     gatctatcag gtaaaaacgg gattatttct atgaaggagg cgaactaa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page