(data stored in ACNUC7421 zone)

EMBL: CP002355.PE277

CP002355.PE277       Location/Qualifiers
FT   CDS_pept        268949..270454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0278"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1007 NADH:ubiquinone oxidoreductase subunit
FT                   2 (chain N); InterPro IPR010096: IPR001750; KEGG:
FT                   tdn:Suden_1815 NADH dehydrogenase subunit N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); SPTR:
FT                   NADH-quinone oxidoreductase subunit N; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain N;
FT                   PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32945"
FT                   /db_xref="GOA:E4TYG8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG8"
FT                   /protein_id="ADR32945.1"
FT                   /translation="MLEPIHVSLASLNLATLAPMLIAIVGALGILVIDMVKGGLNKTLY
FT                   VMVSLLFLLLDLGALVDFAGVFIKNGTVLGFFDVMLMDGIAILSQIIIVVGSMLFIPLA
FT                   LTSKRFHEYNYPEYFALFLFMIAGFQFMVATDNLILIFVGLETASLALYTLIALHNRSK
FT                   SFEAAVKYFTMGALAAGFYAFGSMILYAISGSVEINQIATILAEDHYRNIGFVLLAMAF
FT                   MIAAFGFKLSMVPFHTWTPDVYEGSSAALAGYMSIVPKIAAFVVAMRLFEFLVHSGIVW
FT                   LQVILYIGVVVTMTASNIWALVQTDVKRMLAYSSISHAGFVMSAILIGTTQANTGLFLY
FT                   WALFSFTNLGAFTMLWVNRQKNLLPGQSSDHPYEKFSGMIKTMPMGAVMMGLFMLSLAG
FT                   IPPFGLFWGKMYMIGAAVSAGYTVLALIMALNSAIAGYYYLKLIVFMFMKEPRVGYEKY
FT                   YFMNASLSLRTIIGLAAVGTIFAVFAVNPLLKVITLFVYNSGY"
     atgttagagc cgattcatgt ttctctggcg tcgcttaatt tagcgacgtt ggctccgatg        60
     ctcattgcta tcgtcggtgc attgggtatt ttagtcattg atatggtgaa aggtggattg       120
     aacaaaacgc tatacgttat ggtcagtctt ctctttttgc ttctcgattt gggtgcattg       180
     gtcgatttcg ccggtgtatt tatcaaaaac gggacggtgt taggattctt tgatgtcatg       240
     ctgatggacg ggatcgctat tctgtctcag attattatcg ttgtcggatc gatgttattt       300
     atcccattgg ctttaacgtc aaaacgattc cacgagtaca actatccgga atatttcgct       360
     ctgttcttgt ttatgattgc gggatttcag tttatggttg caaccgacaa tcttattttg       420
     atttttgtcg gacttgagac cgcatcattg gcactgtata cattgatcgc attgcacaac       480
     cgctcaaaat cgtttgaagc ggcggtaaaa tattttacca tgggtgcttt agcagcaggt       540
     ttttacgcgt tcggttccat gatcctttat gcgatcagcg gttcggttga gattaaccaa       600
     atcgcaacga tattggcgga agatcactac agaaacatag gttttgtatt gcttgcaatg       660
     gcgtttatga ttgcggcatt cggatttaag ctttcaatgg ttccgtttca tacatggacg       720
     ccggacgttt atgagggttc atctgcggca cttgccggat acatgtcgat tgttcctaag       780
     attgcggcat ttgtcgtggc gatgcgcttg tttgaattct tggttcacag cggtatcgta       840
     tggcttcaag tgatcttgta tatcggggtt gtcgtaacga tgaccgcatc aaatatctgg       900
     gcgttggttc aaaccgatgt caaacggatg ctggcgtaca gttcgatcag tcatgccggt       960
     tttgtaatgt cggctatttt gatcggtacg acccaagcca ataccggcct ctttttatat      1020
     tgggcattgt tcagctttac caatctcggt gcatttacca tgctgtgggt aaaccgtcag      1080
     aaaaatcttt taccgggaca aagttcggat catccgtacg aaaaattctc gggaatgatc      1140
     aaaacgatgc cgatgggtgc ggtaatgatg gggctcttta tgctttcact cgcagggatt      1200
     cctccgtttg gtctcttctg gggtaaaatg tacatgatcg gagcggcggt aagtgccgga      1260
     tacaccgtgt tggcacttat tatggcgctt aactcggcaa tcgccgggta ctattattta      1320
     aaactcatcg ttttcatgtt tatgaaagag ccgagagtgg gatatgagaa atattatttt      1380
     atgaatgcct ccctctccct tagaaccatt atcggtcttg cggcggtcgg aacgattttt      1440
     gccgtatttg cggtaaaccc tttgttgaaa gttattacgc tattcgtgta taatagcggc      1500
     tattaa                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page