(data stored in ACNUC7421 zone)

EMBL: CP002355.PE278

CP002355.PE278       Location/Qualifiers
FT   CDS_pept        270476..272833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0279"
FT                   /product="Tetratricopeptide TPR_1 repeat-containing
FT                   protein"
FT                   /note="InterPro IPR019734: IPR013026: IPR001440; KEGG:
FT                   tdn:Suden_1814 TPR repeat-containing protein; PFAM:
FT                   Tetratricopeptide TPR_1 repeat-containing protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32946"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG9"
FT                   /protein_id="ADR32946.1"
FT                   /translation="MKFWIILSLCLPLFGLELSIQSGKEEGEKFSILHLRHTVPFACKA
FT                   MDDEFGETKRIECYLPTPPKQNFSPIDNGQLLVSSSTTSNGYTITVLPKSKIKLIPVLF
FT                   NLTKTKETYQNDAKKAFHWNIVGYQSNLPLISLSSSSATAINFPIKIAKSPPPFVGGLD
FT                   LKGNPIKITRVQDVTDYMEMKKAYAAKNYIKVIDRAENTLKEYPNTVFKNELMLYQIRS
FT                   YHQLGEFEKVLALSKRFLREFSSDPGLAEVLTYTANAYSKIGQITDADYFFDRLFDEQG
FT                   DSPFAPQGMIYKAEQLETNGEPKKAAQYYKKALSSTTDVAIASKAAFKLAQSELMSGDV
FT                   QKAAQYVDKIITVNPDYFSEVTDDAINMATSFMDKKDPKTAARLTEALLNKSDKKSDNY
FT                   QLLLKNLGLQLAKAGKRGEALKRFNEYLESFKYGDYAEEVRRAKDGLFFNEGDTNTTEE
FT                   IKKYNDLIDRYGDDSVGRKALYKKAQLLLKEKKYKEVLDIESDLYRLDSTEYPETNQLI
FT                   SKSAIGFEKSLLKEGKCADAMKFQKMYKIKLLPEWDESLFNCALKTAQYPTAKKIAQSH
FT                   LKSNSVAERQIWLFRMVKTQFGLGEYKAASKGGEELITLLGVQKNPPLNEIYRIMFDAA
FT                   QRVGDSDAMIRNIKSIEGVFPNDFTDIERYTQMVSLGLKRKDEAMTQTYSRKVITLQER
FT                   TKSYTQSPYIEFTLAQSYQNLGKDTDALNVLKTLNKQKLNTEKRARQQYLIGAIEQKLG
FT                   RKREARDAFNASIKADKNSAWGKLAKDALALF"
     ttgaagttct ggattatttt atccctttgt cttcccctct tcggacttga actctctatt        60
     caaagcggca aagaagaggg tgaaaaattt agtattcttc atcttcgtca tactgtcccc       120
     tttgcgtgta aagcaatgga cgatgaattc ggtgaaacaa agcggattga gtgttatctt       180
     ccgacaccgc ctaaacaaaa tttttctcct atcgataacg gacaactgtt agtatcctct       240
     tcaacaacat cgaatggtta tacgattacc gtacttccaa aatcaaaaat caaacttatt       300
     ccggtcctct ttaatctgac aaaaacgaaa gagacatatc aaaatgatgc gaaaaaagca       360
     tttcattgga atattgtcgg atatcaaagt aatcttcccc ttattagtct ttcttcatcc       420
     tcggcaaccg caattaattt cccgatcaaa attgcaaaaa gtccccctcc ctttgtcggc       480
     gggctagacc taaaaggtaa tccgatcaaa attacgcggg tacaagatgt caccgattat       540
     atggagatga agaaagcgta tgcggcaaaa aattatatca aagtcattga ccgtgccgaa       600
     aatactctaa aagaatatcc gaatacagtt ttcaaaaatg agctgatgct ctatcaaatc       660
     cgctcatacc atcagctggg ggaatttgaa aaagttttgg cattatccaa acgtttttta       720
     cgggaatttt cgtccgatcc tggacttgcg gaggttttga cctatacggc caacgcctac       780
     agtaagatcg gacaaataac cgatgccgat tatttctttg acaggctgtt tgatgagcaa       840
     ggcgacagtc cgtttgctcc gcaaggaatg atttataagg cagagcagct ggagacgaac       900
     ggagaaccga aaaaagcggc gcaatattat aaaaaagcac tctcgtcaac aacagacgta       960
     gccattgcgt ccaaagcggc atttaaactc gcccagagtg aactaatgag cggagatgtt      1020
     caaaaagcgg cacagtatgt tgataaaatc ataacggtga atcctgatta tttcagtgaa      1080
     gtaacagatg acgcgataaa tatggccact tcctttatgg ataaaaaaga tcctaaaacg      1140
     gctgccagac tcacggaagc gctattgaac aaaagtgata agaagtcgga taattatcag      1200
     ctattgctta aaaatctcgg gctccaatta gcaaaagccg gaaagcgggg cgaagcatta      1260
     aagcgcttta acgaatattt agaaagtttc aaatacggtg attatgccga agaggtaaga      1320
     cgggcaaaag acggcctctt ttttaatgaa ggggatacca atacgacgga agagatcaag      1380
     aaatacaacg acttgatcga tcgctacgga gacgacagtg tcggacgaaa agcgctgtat      1440
     aaaaaagcac agctattgct taaagagaaa aaatacaaag aggtattgga cattgagagt      1500
     gatctttatc gattggattc gaccgagtat cccgaaacca atcagctgat ttcaaaaagc      1560
     gctatcggat ttgaaaagtc ccttttaaaa gagggaaaat gcgccgatgc gatgaaattc      1620
     cagaaaatgt ataaaattaa acttcttccg gagtgggatg aatcgctatt taactgtgca      1680
     ttgaaaacag cacaatatcc gacggctaag aaaatagcgc agagtcatct gaaatctaat      1740
     tctgtagccg aacggcagat ttggctcttt agaatggtaa aaacgcagtt cgggttagga      1800
     gaatataaag cggcgagcaa gggaggagaa gagctgatca cccttttggg ggtacaaaag      1860
     aatccgcctc tcaatgagat ttatcgtatc atgtttgatg ccgctcaacg tgtaggggac      1920
     agcgatgcaa tgattcgcaa tatcaaatca atcgaaggcg tttttccgaa tgattttacc      1980
     gatattgaac gctataccca aatggtgagt ttagggctga aacgcaaaga cgaggcgatg      2040
     acacagacat attcacgcaa agtcattacg ttgcaggaac ggacaaagag ctatacacaa      2100
     agcccttata tcgagttcac attggcacag tcgtatcaaa atctaggtaa agacacggat      2160
     gctctaaatg tattaaaaac gttaaacaaa caaaaactta atacggaaaa acgtgcccga      2220
     cagcagtatc ttatcggtgc gattgagcaa aaactagggc gcaaacgtga agcacgtgat      2280
     gcgtttaacg cgagtatcaa agcggacaaa aattccgcat ggggcaaact ggctaaagac      2340
     gcactagcgc tgttttaa                                                    2358
//

If you have problems or comments...

PBIL Back to PBIL home page