(data stored in ACNUC7421 zone)

EMBL: CP002355.PE28

CP002355.PE28        Location/Qualifiers
FT   CDS_pept        complement(29804..30568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0028"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="COGs: COG2334 Putative homoserine kinase type II
FT                   (protein kinase fold); InterPro IPR002575; KEGG:
FT                   ant:Arnit_1841 aminoglycoside phosphotransferase; PFAM:
FT                   aminoglycoside phosphotransferase; SPTR: Aminoglycoside
FT                   phosphotransferase; PFAM: Phosphotransferase enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32696"
FT                   /db_xref="GOA:E4TW80"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW80"
FT                   /protein_id="ADR32696.1"
FT                   /translation="MGVKRVITLSDLPASLGVQTLASSTDGVMDSVYFLDDDRVVKIFE
FT                   TASEEAVAEELKLLIHCGSLHVSRAEGGVFRVQNKPALIYRRCRGESLKDAGIDEIRQI
FT                   GAFLRDFHHLTAGRRSTNERLFEKSRLARMIRETHTDIFDTLLKKNDLTLRDEGIIHGD
FT                   LFLDNALFLEGRLSCVIDFTQACNGDFLFDLAVTDLSWCDSDEKTEALLKSYGATLTLD
FT                   EFRPYREYATLFYCVNRYLNGGNYQELLEKLV"
     atgggtgtga agagggttat taccctatcc gatctacccg cgtcgctggg ggtacaaacc        60
     ctcgcttcca gcacggacgg ggtaatggac agtgtctatt ttctggacga tgatcgggtc       120
     gtaaaaatct tcgaaacggc gagcgaagag gcggtagccg aggagctgaa acttctcatc       180
     cactgcggat cgctccatgt ctccagagcg gaggggggag tgtttcgggt gcagaacaaa       240
     cccgccctca tctaccgccg ctgtcgcggg gagagtctga aggatgccgg aatcgatgag       300
     atacggcaga tcggagcgtt tttgcgggat tttcatcatc tcacggcggg acgtcgaagc       360
     acgaatgagc ggttgttcga aaaatcacgc ttagcgcgga tgatccggga gacgcatacg       420
     gatattttcg atacgctgtt gaaaaaaaat gatctcacgc tgcgcgatga ggggatcatt       480
     cacggcgatc tctttttgga caatgcccta tttttggagg ggagactctc ctgcgtcatc       540
     gattttaccc aggcatgcaa cggcgatttt ctcttcgatc tcgccgtcac cgatctctcg       600
     tggtgcgaca gcgatgaaaa aaccgaggct ctgctgaaga gctacggcgc tacgctcaca       660
     ctggacgagt ttcgtcccta ccgcgagtat gcgacgctgt tttattgcgt caaccgctac       720
     ctaaacggcg gcaattatca agaactattg gagaaattag tatga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page