(data stored in ACNUC7421 zone)

EMBL: CP002355.PE281

CP002355.PE281       Location/Qualifiers
FT   CDS_pept        274730..275251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1810 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32949"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH2"
FT                   /protein_id="ADR32949.1"
FT                   /translation="MSDIRLVQATIDLAYEEVLDNNEKFEHEFNLIGVAEENSITQGIK
FT                   HVKVRGELDETNALMLNIMAELYRKMEKIEMLLSNGKINRLELSSKGLIDSIGLEHFKL
FT                   SSDSLEVGKHYYGRMEIATFPKREIALYFEAVEPSLAKIENIHVRDKEAWGYYMTACER
FT                   VMIRQMKGLE"
     atgagcgata taagattagt acaggcgaca atcgatttgg catacgaaga ggtgcttgac        60
     aacaatgaga aatttgaaca tgaatttaat ttaatcgggg tagcggaaga aaattcgatc       120
     acgcagggga taaaacatgt caaggttcgc ggagagttgg atgaaacgaa cgctttgatg       180
     ctcaatatta tggctgagtt gtatcgtaag atggaaaaaa ttgagatgct tctgagcaac       240
     gggaaaataa accgtcttga actttcgtcc aaagggctca ttgatagtat cgggctggaa       300
     cattttaaac tcagctcgga ttctttagag gtcggaaaac attattacgg aagaatggaa       360
     atcgcaacgt ttccgaaacg ggaaatcgcc ctctatttcg aagcagttga gccgtcgttg       420
     gcaaaaatag aaaatatcca tgttcgggac aaagaggcat gggggtatta tatgacagcg       480
     tgcgaacgtg ttatgattcg tcaaatgaaa gggcttgaat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page