(data stored in ACNUC7421 zone)

EMBL: CP002355.PE283

CP002355.PE283       Location/Qualifiers
FT   CDS_pept        complement(275894..276640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0284"
FT                   /product="protein of unknown function DUF218"
FT                   /note="COGs: COG1434 conserved hypothetical protein;
FT                   InterPro IPR003848; KEGG: sun:SUN_1551 hypothetical
FT                   protein; PFAM: protein of unknown function DUF218; SPTR:
FT                   Putative uncharacterized protein; PFAM: DUF218 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32951"
FT                   /db_xref="GOA:E4TYH4"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH4"
FT                   /protein_id="ADR32951.1"
FT                   /translation="MFELKKLISSFIYPFPIFLISSALALYLLQRGNRRRAKILFVFSF
FT                   AWITILSYPPFSALLLKPLENAYPKVQLHSPFPRYIHVLGNGHTSSQNIPLSSELSLTS
FT                   LARVNEGILLYKSHPGMKLIFSGYGGGDSVSNARKNSQLAIALGVNSNDIVILEEAKDT
FT                   AEEAIAVKKIVGSQPLILVTSASHMVRASSIFRKNGICVIEAPTDFLVKKEDTLWQFPS
FT                   SGGLRRSECAFHEYLGLLWEKLKGSL"
     atgtttgaac taaaaaagct tatatcctct ttcatctacc cttttccgat ctttttgatc        60
     tctagtgccc ttgccttata ccttttgcaa agaggaaata gacgacgagc caaaattcta       120
     tttgtcttct ctttcgcttg gattactatt ttgtcctatc ccccattttc ggcactgctg       180
     ctcaaacctc ttgaaaatgc ttatcccaaa gtacagctgc attctccgtt tccgcgctat       240
     attcatgttc tcggaaacgg ccatacttcg agtcaaaaca ttccgctctc atctgagctg       300
     agccttacat cattggcacg cgtcaacgaa ggaatattgc tctataaaag tcatccgggt       360
     atgaaattga tttttagcgg atacggggga ggagacagtg tcagcaatgc ccgaaaaaat       420
     tcccaactgg caatcgcact cggcgtcaat tccaatgata tagttattct ggaagaagca       480
     aaggatactg cggaagaagc gatagcggtt aaaaagattg tcggatcgca gccgcttatt       540
     cttgtgacat cagcttccca tatggttcgg gcatcatcta tttttcgtaa aaacggtatt       600
     tgtgttattg aagccccaac tgattttctc gtcaaaaaag aagataccct atggcagttt       660
     ccctcatcag gcggattgcg tcgctcagaa tgtgcatttc atgaatattt aggtttattg       720
     tgggagaagt taaaaggaag tctctaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page