(data stored in ACNUC7421 zone)

EMBL: CP002355.PE284

CP002355.PE284       Location/Qualifiers
FT   CDS_pept        complement(276658..276987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0285"
FT                   /product="iojap-like protein"
FT                   /note="COGs: COG0799 Iojap protein; InterPro IPR004394;
FT                   KEGG: tdn:Suden_1756 iojap-related protein; PFAM:
FT                   Iojap-related protein; SPTR: Iojap-related protein;
FT                   TIGRFAM: iojap-like protein; PFAM: Domain of unknown
FT                   function DUF143; TIGRFAM: iojap-like ribosome-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32952"
FT                   /db_xref="GOA:E4TYH5"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH5"
FT                   /protein_id="ADR32952.1"
FT                   /translation="MNPRIEKISAILDQNKAEAIEVFDLQGGDYFADYVVIASSLGERH
FT                   TLALLDHLKKGLKPEEQFLYVDESGDWVAIDLGDILVHILTPQYRVKYDLESFLGEIAA
FT                   RKNKA"
     gtgaatccac gaattgaaaa aatcagcgcg atcttagacc aaaacaaagc cgaagcaatc        60
     gaagtattcg atcttcaagg tggcgattac ttcgctgact acgttgttat cgcctcatca       120
     ttaggggaac gccatacgct ggcacttctc gatcatctca aaaaagggct aaagcctgaa       180
     gagcagtttt tgtatgttga tgagagcgga gactgggtcg ctatcgatct aggcgatatt       240
     ctcgttcaca tcctcacccc acaataccgt gtcaaatacg atttggaaag cttcttgggt       300
     gagattgccg cacgaaaaaa taaagcataa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page