(data stored in ACNUC7421 zone)

EMBL: CP002355.PE285

CP002355.PE285       Location/Qualifiers
FT   CDS_pept        complement(276984..277517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0286"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COGs: COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase; InterPro IPR005248: IPR004821:
FT                   IPR004820; KEGG: tdn:Suden_1755 nicotinate-nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase; PRIAM:
FT                   Nicotinate-nucleotide adenylyltransferase; SPTR: Probable
FT                   nicotinate-nucleotide adenylyltransferase; TIGRFAM:
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32953"
FT                   /db_xref="GOA:E4TYH6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH6"
FT                   /protein_id="ADR32953.1"
FT                   /translation="MKLALYGGSFDPPHAGHVAVVEEALRVLPIDRLIVVPASRNPFKP
FT                   SVTVDGAVRFEWLKEIFKPYERVVISDFEIAHDRSVYTIETVKHFAPFCDELYLIIGAD
FT                   NLEKLSHWHNFDELDAMVHWVVADRDGISIPENMIRLTTHVPISSTDFRSSYVTLGLDP
FT                   KIEQKIITYYKEHL"
     atgaagcttg cactctacgg cggaagtttc gatccgccgc atgccggaca cgttgctgtt        60
     gtagaagaag ctttacgtgt tttgccgata gacagactca tcgtcgttcc ggcatcacga       120
     aatccgttca agccttccgt cacggttgac ggtgccgttc gtttcgagtg gctgaaagag       180
     atttttaaac cctacgagag agtagttatc agcgattttg aaattgctca tgaccgcagc       240
     gtttatacga ttgaaaccgt taaacatttc gctccgtttt gcgatgaact ctacctcatc       300
     atcggagcgg acaatctcga aaaactgtct cactggcaca attttgatga actcgatgca       360
     atggtgcatt gggttgttgc tgatcgggat gggatatcca tcccggaaaa tatgattcgg       420
     cttactaccc atgtgccgat cagctcaacc gattttcgtt cttcctatgt cacattagga       480
     ttggacccga agatcgaaca aaaaattatt acctattata aggaacatct gtga             534
//

If you have problems or comments...

PBIL Back to PBIL home page