(data stored in ACNUC7421 zone)

EMBL: CP002355.PE286

CP002355.PE286       Location/Qualifiers
FT   CDS_pept        277599..278603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0287"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase;
FT                   InterProIPR020830: IPR020831: IPR006424: IPR020832: IPR
FT                   020828: IPR020829; KEGG: tdn:Suden_1754
FT                   glyceraldehyde-3-phosphate dehydrogenase; PFAM:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding
FT                   domain; Glyceraldehyde 3-phosphate dehydrogenase, catalytic
FT                   domain; PRIAM: Glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating); SPTR: Glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-terminal domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, NAD binding domain; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32954"
FT                   /db_xref="GOA:E4TYH7"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH7"
FT                   /protein_id="ADR32954.1"
FT                   /translation="MALKIALNGFGRIGRCVTRLIAMRTDVELVAINDMASVEMMLYLL
FT                   QNDSVHGQFGIDAAIIGDDYLQIAGQKVRIFSEKNPENLDFASLGADVVFECSGLFLTG
FT                   ALTKHHLEKGVKKVILSAPTQDSAIPTFVLGVNEHLYAGENIISNASCTTNCLGPIAKI
FT                   LDETYGIEKGLMTTVHAYTNGQAIIDSAHGSDMRRSRAAALNMIPTTTGAAKAISLVLP
FT                   SLEGKLHGQSVRVPTADVSMVDLNVLISRSTSKEELSNLFKSYAEGSLKGILEVDERYR
FT                   VSQDFVGSPFSATVADDLIQVVDGNMVKIMAWYDNEWGYSNRLIEMALFITKQ"
     atggcgttga agattgcatt aaacggattc ggtcgcatag gtcgctgtgt tacccgtctt        60
     atcgccatgc gcaccgatgt tgagcttgtc gccataaacg acatggcttc agtcgagatg       120
     atgctttact tattgcaaaa tgattcggta cacggccaat tcggaatcga tgcggcgata       180
     ataggagatg actacctgca aatcgccggt caaaaggtac ggattttttc tgaaaagaac       240
     cctgagaatc tggattttgc ctcactggga gcggatgtcg tttttgagtg cagcggtttg       300
     tttctaacgg gggccttgac aaaacaccat ttggaaaaag gggtgaaaaa agttattttg       360
     tccgccccga ctcaggacag tgcgatccct acttttgtat tgggagtcaa tgagcatttg       420
     tatgcggggg aaaatattat ttcgaacgca tcgtgtacga ccaattgctt aggaccgatt       480
     gcaaaaatcc ttgatgaaac atacggcatc gaaaaagggc tgatgacgac ggttcatgcc       540
     tataccaacg gccaggcgat tattgactcg gcgcacggaa gcgatatgag acgttcccgt       600
     gctgcggcgc ttaatatgat cccgacgact accggtgcgg caaaggctat cagtctggta       660
     ctgccgtcgt tagagggcaa gctgcacggt caaagcgtac gggttccgac agcggatgtg       720
     tcgatggtcg atttgaatgt tctcatcagc cgttctactt ccaaagagga actgagtaac       780
     ctttttaaat cgtatgccga gggcagtttg aagggaattt tggaagtaga tgagcgttat       840
     cgtgtttcgc aggattttgt cggatcacct ttcagtgcca cagtggcaga tgacttgata       900
     caggtcgtcg atggaaatat ggtcaaaatc atggcgtggt atgataatga atggggttat       960
     tccaaccgtc ttatcgaaat ggcattgttt attacaaaac agtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page