(data stored in ACNUC7421 zone)

EMBL: CP002355.PE287

CP002355.PE287       Location/Qualifiers
FT   CDS_pept        278649..279839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0288"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COGs: COG0126 3-phosphoglycerate kinase; InterPro
FT                   IPR015911: IPR001576; KEGG: tdn:Suden_1753 phosphoglycerate
FT                   kinase; PFAM: phosphoglycerate kinase; PRIAM:
FT                   Phosphoglycerate kinase; SPTR: Phosphoglycerate kinase;
FT                   PFAM: Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32955"
FT                   /db_xref="GOA:E4TYH8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYH8"
FT                   /protein_id="ADR32955.1"
FT                   /translation="MQLLGIKECDIHGKKVFIRCDFNVPMDDYGNITDDRRIRSALATI
FT                   NYCLDQKCAIILASHFGRPKGEPDEKYSLAPIARRLHQLLKIDVQVADDVVGESALKLA
FT                   HELKNGEVLLLENLRFEKGETKNDPDLSAALASMAEVYINDAFGVSHRAHASVEGITAH
FT                   FDNAHKAAGFLLQKEIQFFGTLLEHPVRPFAAIVGGSKVSGKLEALINLLPKVDKMLIG
FT                   GGMAFTFLKALGHDVGNSLVEDDLIPEALKIMEEAKRLGVKFYLPVDVVAAEKFAPDSA
FT                   SRLCSVQEIPSGWMGLDIGPATVRLYRQVLGDVQTILWNGPMGVYEMDRYARGSNKIAH
FT                   FVADSYATSVVGGGDTADLVQRVGLDEEITFISTGGGASLELLEGKILPGVKPLLK"
     atgcagttac tcggtatcaa agagtgtgac atccacggca agaaagtatt tattcgatgt        60
     gattttaacg ttccgatgga cgattacggc aatattaccg atgacagacg aatccgctca       120
     gcactagcaa caatcaatta ttgtcttgat caaaaatgtg caattatttt ggcatcacac       180
     ttcggacgtc ctaaagggga accggatgaa aaatattcac ttgcacctat agcccgtcgg       240
     ttgcatcagc ttcttaaaat tgatgttcag gtggcggatg acgttgtcgg agagagtgcg       300
     ttaaaacttg ctcacgagct taaaaacgga gaagtattgc ttctggagaa cctccgtttt       360
     gaaaaagggg agacgaaaaa tgaccctgat ttaagtgctg cattggcttc gatggcagaa       420
     gtgtatatta atgacgcatt cggtgtcagc caccgtgctc atgcttcggt tgaggggata       480
     actgcacatt ttgataatgc acataaagca gccggtttct tgcttcaaaa agagattcaa       540
     tttttcggaa ctttactaga gcatcctgta agaccgtttg ccgcgattgt cggcggaagc       600
     aaagtttcag ggaagcttga agcattgata aacctgctgc cgaaagtgga taaaatgctg       660
     atcggcgggg ggatggcctt cacatttctc aaagcgttgg ggcatgacgt cggaaattcc       720
     cttgttgaag acgatttgat tcctgaagct ctcaaaatca tggaagaagc gaaacggttg       780
     ggagtcaagt tttatttgcc ggtagatgtc gttgcggcag aaaaatttgc ccctgattcc       840
     gccagccgtc tttgcagcgt tcaagagatc ccttcaggat ggatgggact cgatatcggg       900
     cctgcgactg taagactgta tcgtcaggta ctcggtgatg ttcagacgat cctatggaac       960
     gggccgatgg gagtttatga gatggatcga tatgcacgcg gatccaataa aattgcccat      1020
     tttgtcgccg attcctatgc gacgagcgtc gtcggcggag gcgatacggc tgatttggtt      1080
     caacgtgtcg ggttggatga agagattacc tttatctcta ccggaggcgg agcatcactg      1140
     gagttgcttg aagggaaaat tcttcccgga gttaaaccgt tgttgaaata a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page