(data stored in ACNUC7421 zone)

EMBL: CP002355.PE289

CP002355.PE289       Location/Qualifiers
FT   CDS_pept        280576..281400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0290"
FT                   /product="Enoyl-(acyl-carrier-protein) reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /note="COGs: COG0623 Enoyl-(acyl-carrier-protein); InterPro
FT                   IPR002347: IPR002198; KEGG: tdn:Suden_1751 enoyl-(acyl
FT                   carrier protein) reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR:
FT                   Enoyl-[acyl-carrier-protein] reductase (NADH); PFAM: short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32957"
FT                   /db_xref="GOA:E4TYI0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI0"
FT                   /protein_id="ADR32957.1"
FT                   /translation="MLMQGKKGLIVGLANDKSIAYGIAQALHKQGAQMAFTYLNEALQK
FT                   RVEPIAASFDNSPVYKLDVSDEADMEAIAAKVAADFGEIDFLVHSVAFAPKEALTEGFM
FT                   KTSKSAFQIAMDVSVYSLIDLTNRLESVLAPGASIITLSYLGGPKYIPNYNVMGVAKAA
FT                   LESTVRYMAVELGASKGQRVNAISAGPIKTLAASGIGDFKQILNWNESNAPLRKNVTIE
FT                   EVGNSAMYLLSDLSSGVSGEVHYVDAGYNIMGMAAVEKNAEGKSVFVWDANK"
     atgttaatgc aagggaaaaa agggttaatc gtaggacttg ccaacgataa atcgatcgca        60
     tacggtatcg cacaagcgct tcacaaacaa ggggcgcaaa tggcgtttac ctatcttaat       120
     gaagcactgc aaaaacgggt agaaccgata gcggcaagtt ttgacaactc tccggtctat       180
     aaattggatg tatccgatga ggctgatatg gaggcgatcg cagcgaaagt agcggctgat       240
     ttcggagaaa tcgacttttt ggttcactcg gttgcattcg caccgaaaga agcattgacc       300
     gaagggttta tgaaaacgtc aaaaagtgcg tttcaaatcg ctatggatgt ctccgtctat       360
     tctttgatcg acttaacgaa ccgcttagag agcgtattgg ctccgggcgc gtctattatt       420
     accctcagct acctcggcgg accgaaatat atcccgaact acaatgtcat gggtgtcgca       480
     aaagcggcgt tggaatcaac cgtacgctat atggcggtag aactcggtgc atccaaaggg       540
     caacgtgtaa acgcgatcag tgcgggtcct attaaaaccc tggcggccag cggtatcggc       600
     gatttcaaac aaatccttaa ctggaacgaa tccaatgcac cgttacgcaa aaacgtgacg       660
     atcgaagagg tcggaaactc ggcaatgtac ctgcttagcg atctctcaag cggggtcagc       720
     ggtgaagttc attatgtcga tgcgggctat aacatcatgg gtatggctgc ggtagagaaa       780
     aatgctgaag gaaaaagtgt ttttgtttgg gatgcaaaca agtaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page