(data stored in ACNUC7421 zone)

EMBL: CP002355.PE290

CP002355.PE290       Location/Qualifiers
FT   CDS_pept        complement(281671..282210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpi:Rpic_4347 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32958"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI1"
FT                   /protein_id="ADR32958.1"
FT                   /translation="MRHSLSLSIALLILSGCAANHMGVTPSQNTNLQAVSPSTTAASEG
FT                   GIMQRSLDIWLKEEWNPMMANEPTVNTKQQSDGTVITTKTEPTKMSVTTQTSDGKTVQK
FT                   MTNATQITTTMKAPDGTVTTKTEVVPLDEDNTPFTLQKYADKWKSYLEKKEKMNEGKPK
FT                   EPSHIEKINGMPVIGK"
     atgcgccatt ctcttagctt atccattgcc ctgttgatac tcagcggctg tgccgccaat        60
     catatgggag taacgccgtc acaaaacaca aatctgcaag ccgtctctcc cagcactacc       120
     gccgccagtg aagggggaat aatgcagcgt tctctcgaca tctggctcaa agaggagtgg       180
     aaccctatga tggcaaacga acctacggtg aataccaagc aacaaagcga cggcacagtg       240
     ataacgacca aaaccgaacc gactaaaatg tctgttacca cacaaacttc cgacggtaaa       300
     acggttcaaa aaatgacaaa cgccacacag attacgacta ccatgaaagc tcccgacggc       360
     accgtcacaa ctaaaaccga agttgtccct ctggatgaag acaatacgcc gtttaccctg       420
     caaaaatacg ccgataaatg gaaatcctat ttggaaaaga aagagaagat gaatgaggga       480
     aaaccgaaag agccgtctca tatcgaaaaa ataaatggta tgccggttat cggcaagtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page