(data stored in ACNUC7421 zone)

EMBL: CP002355.PE291

CP002355.PE291       Location/Qualifiers
FT   CDS_pept        282461..283801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1487 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32959"
FT                   /db_xref="GOA:E4TYI2"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI2"
FT                   /protein_id="ADR32959.1"
FT                   /translation="MKLVKMSLAAAVLLGASAFAIDNVKVSGDAKLYYNTNNADYLDGS
FT                   GNKQSGLFDKAASAADTALTLGVTGDLTKGVSFGVKGIAVSTLGLENNLVSNTWTGAHD
FT                   AKANGSSFGAQVDDQAWISEMWVAATLGKTTAKLGRMELDTPFAFSEKWSIATNTFDAA
FT                   VLINQDIPDTTLVGAWVGKGNGVNAIGAYSLNGVPSNTPAVGIDGIVGAGANFDTFASD
FT                   GAYAAALVNNSFKPLTFQAWYYNVVDVADTYWLQADIDCQLVKGVKIGAQYANMSPKGN
FT                   IESTLDGIGSNDNSSAYAFKLGYEGVQNLKVSAAYSKADSDGVLKIANVATNNLGAAQS
FT                   KLYTEAWWNYGYVGAPDARSWNVTAEYDAGLAKLGAYYTDVSIDDTNVVNQAVGGKDNV
FT                   DMKEIAVTATKSFGPLDATLAYISTDADDQNTGDRYDTVQAYLTLNF"
     atgaagttag ttaaaatgag tcttgcagca gcagtgttgc tcggagcgag cgcattcgca        60
     atcgataatg taaaagttag cggtgatgct aaactttatt acaacacaaa caatgctgat       120
     tatctagatg gcagtggtaa taaacaaagt ggtctgtttg acaaagcagc aagtgcagcg       180
     gatacagctc ttactcttgg tgtaacaggt gatttgacaa aaggtgtctc tttcggcgtt       240
     aaaggtattg ctgttagtac tcttggtctt gaaaacaacc ttgtaagcaa cacatggaca       300
     ggtgcacatg atgcgaaagc aaacggttca tcttttggtg ctcaagttga tgaccaagca       360
     tggatcagtg aaatgtgggt tgctgcaact cttgggaaaa ctacggcaaa acttggacgc       420
     atggagctag atactccatt tgctttctct gaaaaatggt ctatcgcgac aaacacattt       480
     gacgcagcgg ttcttatcaa ccaagacatc cctgatacaa ctctagtagg tgcatgggta       540
     ggaaaaggaa atggtgttaa tgctattgga gcatactcat tgaatggtgt tcctagcaac       600
     actcctgctg ttggaatcga tggtatcgta ggtgctggtg caaacttcga tacatttgct       660
     agtgacggcg cgtatgcagc agcattggta aacaactctt tcaaacctct tacattccaa       720
     gcatggtact acaacgttgt tgacgttgct gatacttact ggttgcaagc agacatcgat       780
     tgccaattgg ttaaaggtgt aaaaatcggt gcacaatatg caaatatgtc accaaaaggt       840
     aacattgaat caacattgga tggaatcgga tcaaacgata attcatctgc atatgcattc       900
     aaacttggat atgaaggtgt tcaaaatcta aaagtttctg ctgcatattc aaaagcagat       960
     tcagacggtg tattgaaaat tgctaacgtt gcaacaaata accttggtgc tgctcaatct      1020
     aaattgtaca ctgaagcatg gtggaactac ggatacgttg gtgctccgga tgctcgttct      1080
     tggaacgtaa cggctgagta cgatgcaggt cttgctaaac ttggcgcata ctatacagat      1140
     gtatcaatcg atgatacgaa tgtggtcaac caagcggttg gtggaaaaga caatgtcgat      1200
     atgaaagaaa ttgcagttac tgcaactaaa tcgttcggac cgttggatgc gactttggct      1260
     tatatctcta cagatgctga cgatcaaaat accggtgatc gttacgacac tgtacaagct      1320
     tacttgactc ttaacttcta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page