(data stored in ACNUC7421 zone)

EMBL: CP002355.PE293

CP002355.PE293       Location/Qualifiers
FT   CDS_pept        complement(285115..286248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0294"
FT                   /product="NusA antitermination factor"
FT                   /note="COGs: COG0195 Transcription elongation factor;
FT                   InterPro IPR010213: IPR003029: IPR013735; KEGG:
FT                   tdn:Suden_1748 transcription elongation factor NusA; PFAM:
FT                   NusA domain-containing protein; SPTR: Transcription
FT                   termination factor NusA; TIGRFAM: transcription termination
FT                   factor NusA; PFAM: NusA N-terminal domain; TIGRFAM:
FT                   transcription termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32961"
FT                   /db_xref="GOA:E4TYI4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI4"
FT                   /protein_id="ADR32961.1"
FT                   /translation="MENILDIIESIANEKGLNPDRVQEAIKTSFIQTAKRIINPTFAFE
FT                   ADIDDRTKQVRLRQIITVVADDAPELEGEEAGAYMGITAALEIDDEAEIGDQLQMEHDI
FT                   ESYGRSAFATLHREIEFHIQRLVENELYDKYKSKINQIVSGRVTRVDSDQNTTIEIDEI
FT                   RAVLPMKSRIKGEKFKVGDVVSAIVRRVHVDKSNGISMELSRTAPKFLEELLALEVPEI
FT                   KDGIVVIEKCARIPGERAKIALYTNRPQIDPIGATVGVRGVRINAVSEELCGENIDCVE
FT                   YSSSPELFISRAMSPAIISAVVVTENEGEEKKAVVTLPSDQKSKAIGKSGINIRLASML
FT                   TGYTIELNEVGGSAQMGEKAQEEKKEGLSSLEALFGN"
     gtggaaaata ttttagatat tattgaatct atcgcaaacg aaaaagggct taatccggat        60
     cgtgttcaag aggcgattaa aacctcgttt atccaaaccg ccaaacgaat aattaatcca       120
     acttttgctt ttgaagctga tattgacgat cgtaccaaac aggttaggct acgacaaatc       180
     attaccgtcg ttgccgacga tgctccggaa cttgagggtg aagaggcggg cgcgtatatg       240
     ggtattaccg cagcattgga aatcgatgac gaagcggaaa tcggcgatca gctccaaatg       300
     gaacacgaca tcgaaagcta cggacgaagc gcgtttgcca ccttgcaccg agaaatcgaa       360
     tttcatatcc agcgccttgt tgaaaacgag ctttacgaca aatacaaaag taaaatcaat       420
     caaatcgtat ccggccgcgt tacccgtgta gacagcgacc aaaataccac catcgaaatt       480
     gatgagatcc gtgcggtatt gccgatgaaa agccgtatca aaggtgaaaa attcaaagtc       540
     ggcgatgttg tgagtgccat cgttcgccgt gtccacgttg acaaaagcaa cggtatttcg       600
     atggagctct cacgaaccgc tccgaaattt ctcgaagagc ttttggcatt ggaagttcct       660
     gagatcaaag acggcatcgt cgttatcgaa aaatgcgccc gtattccggg tgagcgtgcg       720
     aaaatcgccc tctacaccaa ccgacctcaa atcgatccga tcggtgcaac cgtcggggta       780
     cgcggtgtcc gtatcaacgc ggtaagcgaa gagctgtgcg gtgaaaacat cgactgtgtc       840
     gaatacagtt cgtctcccga acttttcatc tcccgtgcga tgtctcctgc cattatcagt       900
     gccgttgtcg taactgaaaa tgaaggcgaa gagaaaaaag cggttgttac cctcccaagc       960
     gaccaaaaat ccaaagcaat cgggaaaagc ggtatcaaca tccgtttagc atcaatgcta      1020
     acaggatata caatcgagct gaatgaagtg ggcggaagcg ctcaaatggg tgaaaaagct      1080
     caggaagaga aaaaagaggg gcttagctcg ctcgaagcgc tttttggaaa ctag            1134
//

If you have problems or comments...

PBIL Back to PBIL home page