(data stored in ACNUC7421 zone)

EMBL: CP002355.PE294

CP002355.PE294       Location/Qualifiers
FT   CDS_pept        286420..286662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1747 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32962"
FT                   /db_xref="InterPro:IPR040748"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI5"
FT                   /protein_id="ADR32962.1"
FT                   /translation="MELKLARSEHDSKPKKIDLKKITEMVEKSNSSILYFDRENSHKDL
FT                   LALQDHFEGEGKSFYMREVKYGLSANEYMYEVHIL"
     atggaactca aactcgcccg cagcgaacat gactcaaaac caaaaaaaat cgatctcaaa        60
     aaaattaccg aaatggtaga gaaaagcaac tcttctatcc tctatttcga ccgtgaaaac       120
     tcacacaaag accttcttgc acttcaagac catttcgagg gagaagggaa aagtttttac       180
     atgcgtgaag tgaaatacgg actctctgca aatgaataca tgtatgaggt tcatatatta       240
     tag                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page