(data stored in ACNUC7421 zone)

EMBL: CP002355.PE295

CP002355.PE295       Location/Qualifiers
FT   CDS_pept        286778..288079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0296"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterProIPR020612: IPR006463: IPR005839: IPR002792: IPR
FT                   013848: IPR007197: IPR006638; KEGG: tdn:Suden_1746
FT                   (dimethylallyl)adenosine tRNA methylthiotransferase; PFAM:
FT                   protein of unknown function UPF0004; Radical SAM domain
FT                   protein; deoxyribonuclease/rho motif-related TRAM; SMART:
FT                   Elongator protein 3/MiaB/NifB; SPTR: tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; TIGRFAM: tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; RNA modification enzyme, MiaB
FT                   family; PFAM: TRAM domain; Radical SAM superfamily;
FT                   Uncharacterized protein family UPF0004; TIGRFAM:
FT                   tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme
FT                   MiaB; RNA modification enzyme, MiaB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32963"
FT                   /db_xref="GOA:E4TYI6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI6"
FT                   /protein_id="ADR32963.1"
FT                   /translation="MSKKLFIETLGCAMNVRDSEHMIAELNAHEGYELTDDAASADLIL
FT                   INTCSVREKPVHKLFSELGVFNKLKKADAKIGVCGCTASHLGKEIIKRAPYVNFVLGAR
FT                   NVSKIADVLHRDRAVEVEIDYDESQFAFKDFRSSPYKAYINISIGCDKQCTFCIVPKTR
FT                   GDEISIPPDLIVAEVRKAVENGAKEVFLLGQNVNNYGRRFSDVNDKMNFTELLRRVSAV
FT                   EGLERIRFTSPHPFHMDDEFLEEFARNPKICKSMHMPLQSGSTDILKAMKRGYTKEWFL
FT                   NRARKLRELVPDVSISTDIIVAFPGESDADFEDTLDVMKEVRFEQVFSFKYSPRPLTEA
FT                   ESFTNVVDSELGSFRLSTLQAYQDTILDSISAGLLGKEYDVYFEELRSDGYVAGRSDNN
FT                   IMIKVKGSEEWLGKIARVKITEVSRSVQYGEIIA"
     atgagtaaga aactttttat cgagacactc ggatgtgcta tgaatgtgcg cgattccgag        60
     catatgatcg ctgagttgaa tgcccatgag gggtacgaac tcaccgatga cgcggcttcg       120
     gccgatctga tcctcatcaa tacctgttcg gtacgcgaaa aaccggttca caaacttttt       180
     tccgaactcg gtgtctttaa caaactcaaa aaagcagatg ccaaaatcgg tgtatgcgga       240
     tgtacggcat cccatctggg taaagagatt atcaagcgtg ccccttatgt caattttgtc       300
     ctcggtgccc gcaatgtttc taaaattgcc gatgtccttc atcgtgatcg tgcagtcgaa       360
     gtcgagatcg attacgatga atctcaattt gcgtttaaag atttccgcag cagcccttat       420
     aaagcctata tcaacatctc catcggctgc gacaagcagt gtactttttg tattgtccct       480
     aaaacccgtg gagatgagat atcgattccg cccgatttga ttgttgccga agtacgaaaa       540
     gcggtagaga acggagccaa agaggttttt ctcctcggtc aaaacgtcaa caactacggg       600
     cgccgttttt cagacgtaaa cgacaaaatg aacttcactg aattgcttcg acgtgtaagt       660
     gcggtggagg gattggagcg tatccgattc acctctcctc atccgtttca catggacgat       720
     gaatttctcg aagagtttgc ccggaatccg aaaatctgca aatcgatgca catgccgttg       780
     caaagcggat cgaccgatat tctcaaagcg atgaaacggg gatataccaa agaatggttc       840
     ttgaaccgtg cccgcaaact gcgcgaactc gttcctgatg tcagtatcag taccgatatc       900
     atcgttgcgt tccccggtga gagtgatgcc gatttcgaag ataccctcga tgtgatgaaa       960
     gaggtacggt ttgagcaggt atttagtttt aaatactctc cccgtcctct tacggaggcg      1020
     gaaagtttta cgaacgtcgt agactcggaa cttggttcat ttagactgag cacccttcaa      1080
     gcctatcagg acacgattct cgattccatc agtgcaggat tgttgggaaa agaatatgat      1140
     gtctattttg aagaattgcg ctcagacggg tatgttgccg gacggagtga taacaatatc      1200
     atgataaagg tcaaagggag tgaagagtgg ctcggcaaga tcgcacgtgt aaaaatcacc      1260
     gaggtctcac gatcggttca atacggagag atcattgcgt aa                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page