(data stored in ACNUC7421 zone)

EMBL: CP002355.PE296

CP002355.PE296       Location/Qualifiers
FT   CDS_pept        288072..288695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0297"
FT                   /product="protein of unknown function DUF374"
FT                   /note="COGs: COG2121 conserved hypothetical protein;
FT                   InterPro IPR007172; KEGG: tdn:Suden_1745 hypothetical
FT                   protein; PFAM: protein of unknown function DUF374; SPTR:
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF374)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32964"
FT                   /db_xref="GOA:E4TYI7"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI7"
FT                   /protein_id="ADR32964.1"
FT                   /translation="MRKRFLRALALWLIPPIGTLLIRLIYLTNRKRFHLPMSIPNEPVI
FT                   FAFWHGDLLMQPYLYYQFRRNPKANVLISDHFDGQIIARIMRYFKLGTIHGSTTRGGAK
FT                   VLIQGLKSLSEGYDIGITPDGPKGPRHEMSDGVVVMAQKRNAKVIVYSCVPSTFWQLPS
FT                   WDRFTVPKPFGRLDFYASEPIDLGGLEMEAAKALIKAKLMEHVL"
     ttgcgtaaac gttttttacg tgctttggct ttatggctta tccctccgat cgggacgctg        60
     ttaatccgtc ttatctacct taccaatcga aaacggtttc atctcccgat gagtatcccg       120
     aatgaaccgg tcatttttgc tttttggcac ggcgatctct tgatgcagcc gtatctctac       180
     tatcagttcc gtcgcaatcc gaaggccaat gttttgatat ccgatcattt cgacggccag       240
     attatcgccc gtataatgcg ctatttcaaa ctgggaacca ttcacggctc aacaactcgc       300
     ggcggagcca aggttcttat tcaagggctt aaatcgctct cggaagggta tgatatcgga       360
     atcacccctg acggacctaa gggaccgcgc catgagatga gcgacggtgt cgtagttatg       420
     gcgcaaaaac gcaatgccaa agtgatcgta tacagctgtg tcccttccac attttggcag       480
     cttccgagct gggatcgatt taccgttcca aaaccgttcg gaaggttgga tttttatgcc       540
     tccgagccga tcgatctggg tgggttggag atggaagcgg caaaggctct tatcaaagca       600
     aagctgatgg agcatgttct ttag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page