(data stored in ACNUC7421 zone)

EMBL: CP002355.PE297

CP002355.PE297       Location/Qualifiers
FT   CDS_pept        288702..289550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0298"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR004107: IPR002104; KEGG: tdn:Suden_1743 phage
FT                   integrase; PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; SPTR: Phage integrase; PFAM:
FT                   Phage integrase, N-terminal SAM-like domain; Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32965"
FT                   /db_xref="GOA:E4TYI8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI8"
FT                   /protein_id="ADR32965.1"
FT                   /translation="MQMNELYRQKEAFLKYLDTIRGYSPLTIRSYNDAIDEMLTFAEMD
FT                   ASSNLLSINLMPLRLKISSLKAKSIAAKLSAIRSFVKYLRSQGKTVELRGDESIKTPKT
FT                   LPKPITHEQILHALQYAEPQAALAITLLYTMGLRISELTHLRLSDISEGWSRIHGKGSK
FT                   ERDIPMMDNIRTMVQEYQKINPSREYVFELKGEKLSENSLRYTIIKAFAKVGLKVTPHQ
FT                   LRHTYATELLNNGARIADVSELLGHASMATTQIYTKLGNALKMEHYLQSHPLCQTHEDS
FT                   K"
     atgcagatga atgaacttta tcgacaaaaa gaagcgtttt taaaatacct ggatacgata        60
     cgaggttatt ctcccctgac gattcgaagt tacaatgatg ctatcgatga aatgctcacc       120
     tttgcagaaa tggatgcaag cagcaatctc ctttccatca atctgatgcc gctgcgttta       180
     aaaatatctt ctcttaaagc caaatcgatt gccgccaaac tcagtgctat acgcagcttc       240
     gtcaaatatc ttcgctcaca agggaaaacg gttgaactga gaggtgatga gagtattaaa       300
     acacctaaaa ctctgccgaa accaattaca catgaacaaa ttctccatgc actgcaatat       360
     gccgaaccgc aagctgcatt ggcgattaca cttctgtata ccatgggact tcgtatctcc       420
     gaacttaccc acttgcgtct ttcggatatc tcggaaggat ggtcacgtat ccatggaaaa       480
     gggtctaaag aacgcgatat tccgatgatg gataatattc gtacaatggt acaggaatat       540
     cagaagatca acccttcacg agagtatgtt tttgaactta aaggtgaaaa attaagcgaa       600
     aatagtctaa gatataccat tattaaggca tttgcaaagg ttggactgaa agtgactcct       660
     catcaattgc ggcatacata tgcgaccgag ttgttaaaca acggagcacg tattgccgat       720
     gttagtgaat tattggggca tgcaagcatg gcgaccacac agatttatac caaactcggg       780
     aatgctttga aaatggagca ttacctgcaa tcgcatccgt tatgccaaac tcatgaggac       840
     tctaagtga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page