(data stored in ACNUC7421 zone)

EMBL: CP002355.PE298

CP002355.PE298       Location/Qualifiers
FT   CDS_pept        289547..290584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1742 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32966"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYI9"
FT                   /protein_id="ADR32966.1"
FT                   /translation="MIERFYRKIFVAIVQDGGAHDVRVVVQKKRKLLNKQSRKFEGKSA
FT                   LDEIRSYLGKYLDESPLHYVAVLNPAVKQGALPGCRNHLDEEMEEISGAKTLCQNEDWL
FT                   LYSSMRELDSLQTEYKSIGLDFIFSPFSVLEHFFKDKVHGGFALYALAQKDSFSVAFFE
FT                   DGKLEYAHHYPMQEKNTLTLEDESSTMGFAVGIKEEDEIDKGISLDDIESLDDLDILEE
FT                   LDDLSEIEDLDNLDEIVEFSEDEPTFEEKRIVFPRGSEIKQEMDMFNNDYRRFELIQRT
FT                   LARFYRGEHCNDRFVETIFIADAYGSGAELKQYLEEELFLNVSIRHIDVADEVIALAMA
FT                   EEEEL"
     gtgatagaac ggttttaccg aaaaattttc gtcgctattg ttcaagacgg aggagcgcat        60
     gacgttcgtg tggttgttca aaagaaaagg aagcttctta ataaacagag ccgaaaattt       120
     gagggcaaat cagcactaga cgagatccgt tcgtatcttg gcaaatacct tgacgaatct       180
     ccgcttcatt acgtcgcagt attgaatcct gccgtaaaac aaggagcact gcccggatgc       240
     aggaaccatc tggacgagga gatggaagag ataagcggcg caaaaaccct ctgccaaaat       300
     gaagattggc ttttgtacag ttcgatgaga gaactggatt cgcttcaaac ggaatacaaa       360
     agtatcggac ttgattttat cttttcccct ttttccgttt tagaacattt tttcaaagat       420
     aaagtacatg gcggatttgc cctctatgcg ttggcccaaa aagattcatt cagtgtcgct       480
     tttttcgaag acgggaagct cgaatatgca caccattatc cgatgcagga aaaaaacacg       540
     ctgacccttg aagatgaaag cagcactatg ggctttgccg tcggaattaa agaagaggac       600
     gagatagaca aggggatcag cttagatgac atagaatcgc tggatgatct ggatattctc       660
     gaagagctgg atgatttgag tgaaatagag gatttggaca atcttgatga gattgtagaa       720
     tttagcgagg atgaaccgac ctttgaagaa aagcgtattg ttttcccgcg cggcagtgaa       780
     atcaaacaag agatggatat gtttaataat gactatcgcc ggtttgagtt gattcagcgg       840
     acattggcac ggttttacag gggagaacat tgtaatgacc gttttgttga gacgattttc       900
     attgccgatg cctacggaag cggtgctgaa ctgaaacaat atctcgaaga agaacttttc       960
     ttgaatgtat cgatacgaca tattgatgtt gctgatgagg ttatagcgtt agctatggct      1020
     gaagaggaag aactgtga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page