(data stored in ACNUC7421 zone)

EMBL: CP002355.PE299

CP002355.PE299       Location/Qualifiers
FT   CDS_pept        290581..291105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1741 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32967"
FT                   /db_xref="GOA:E4TYJ0"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ0"
FT                   /protein_id="ADR32967.1"
FT                   /translation="MKYSFIAPRKKRLISGELRLVLFFFAVTIAMLVGTYVFLEYKTYD
FT                   FVNERKNVALKEKSIKRSVEVMQEQIKTIEKEAKIVEQVTTSNAVMKESIRNLFDLVPE
FT                   DITLSRAELEEKSLILYGMTPNKDTYEYMLHAPLRSIFNRSYTSFYPIENGWYRFVSSN
FT                   YLDDETVEEIK"
     gtgaagtaca gttttattgc tccccgtaaa aaacggctga tcagcggtga gttgcgtctc        60
     gtccttttct tttttgcggt aacgattgcg atgctggtcg gaacctatgt ttttcttgaa       120
     tacaaaacgt atgattttgt aaacgagcga aaaaatgttg cacttaaaga gaaatcgatc       180
     aaacgttctg ttgaagtaat gcaagagcag atcaaaacga ttgagaaaga ggcgaaaatc       240
     gtcgagcagg tgacaacaag caatgccgtc atgaaagaga gtatccgaaa cctttttgac       300
     cttgtaccgg aagatattac tctctcacgc gctgaattgg aagaaaagtc gctgattctt       360
     tacggtatga ctccgaataa agatacctat gaatatatgc ttcatgcgcc gttgcgatcg       420
     atttttaacc gcagctatac gagtttttat ccgatcgaaa acggatggta ccgttttgtt       480
     tcgtccaact atctggatga tgagacggta gaggagatca aatga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page