(data stored in ACNUC7421 zone)

EMBL: CP002355.PE3

CP002355.PE3         Location/Qualifiers
FT   CDS_pept        2894..5209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR018522: IPR011557: IPR001241: IPR000565: IPR
FT                   003594: IPR013506: IPR006171: IPR002288; KEGG:
FT                   tdn:Suden_0003 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein; SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; SPTR: DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: Toprim domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; DNA gyrase
FT                   B; DNA gyrase B subunit, carboxyl terminus; TIGRFAM: DNA
FT                   gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32671"
FT                   /db_xref="GOA:E4TW55"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW55"
FT                   /protein_id="ADR32671.1"
FT                   /translation="MENYGASNIKVLKGLEAVRKRPGMYIGDTGHRGLHHLIYEVVDNS
FT                   IDEAMAGHCDTITVTLTKNGTAIVSDNGRGIPTDMHPTEGISAATVVLTVLHAGGKFDK
FT                   DTYKVSGGLHGVGVSVVNALSSDLKMTIHREGQSFEQNFKCGIPQEPLAITGTTRKRGT
FT                   TIEFFPDPSIFTETIIFDYDYLAKRFRELAYLNPRITIIFKDERNGASNTYHFEGGISQ
FT                   FVTDVNKKTVVASPFAFSEKIEDIEMDIAIMYNDSYDDKTFTFVNNINTPNGGTHEAGF
FT                   RAGLTRVISNYNKQNGNAKEKDVPLTGEDVSEGLICVVSVRVPEPQFEGQTKGKLGNTY
FT                   VRPLVQKVTYEKLTKYFEENPLQAKAIVQKALMAARGREAAKKARELTRRKDAMTVGTL
FT                   PGKLADCQSKDPAISELYLVEGDSAGGSAKQGRDRVFQAILPLKGKILNVEKARLDKIL
FT                   KSEEITNMITALGCGIGEEFNEEKLRYHKIIIMTDADVDGSHIQTLLLTFFFRYLPKIV
FT                   ENGYLYLAQPPLYRYKKGKKEIYFKDDRVMNAFLIENGIEALEAENLNVGVNDLVSFFK
FT                   MVDHYRSTLDALERRYALVELIRYFIENPDLISLPLTEMYTKVEAFLTAQGNNILSKSV
FT                   SDEDMHLFVQTKEGLEELHINDELFASPHFAEANYIFQKIQDWNLPLEGDLLELLTQIT
FT                   DYAKKGSYIQRYKGLGEMNPEQLWETTMTPENRVLLRITIEDAETAGESFNLFMGDDVE
FT                   PRRNYIETHAKDVKHLDI"
     atggaaaatt acggtgctag taacattaaa gtcctaaaag gtcttgaagc cgttcgaaaa        60
     cgaccgggta tgtatatcgg tgataccggt catcgcggac ttcatcactt gatctacgaa       120
     gtcgttgaca actcaatcga tgaagcgatg gcgggacatt gtgatacgat cacggtaaca       180
     ttgaccaaaa acggtaccgc aatagtaagc gataacggtc ggggtattcc gaccgacatg       240
     catccgacag agggaatttc tgcggcaacg gttgttttga ccgtattgca cgcaggggga       300
     aaattcgaca aagatactta taaagtctcg ggcggtttgc acggggtagg ggtatcggtt       360
     gttaatgccc tcagtagtga tctcaaaatg acaatccacc gtgaaggtca atcgtttgag       420
     caaaacttta aatgcggtat tcctcaagag cctttggcca taacaggcac aacacgtaaa       480
     cgtggaacaa ccattgagtt tttcccggat ccttcgatct ttaccgaaac gattattttt       540
     gattatgact atttggctaa acgtttccgt gaactcgctt acctgaatcc tcgaatcacc       600
     attattttca aagacgaacg taacggcgcg agcaatactt accatttcga agggggtatc       660
     agccaattcg ttaccgatgt gaacaaaaaa acggttgtgg cttcaccgtt tgcgttcagt       720
     gaaaaaatcg aagatatcga gatggatatc gcaattatgt ataacgacag ttatgacgac       780
     aaaacgttta cgttcgttaa taacatcaat acacctaacg gcggaactca cgaagcgggt       840
     ttccgtgcgg gtcttacccg tgttatctca aactacaaca aacaaaacgg taatgccaaa       900
     gaaaaagatg tccctctgac cggcgaagat gtatccgaag ggcttatctg tgttgtttcc       960
     gtacgggtac cggagcctca gtttgaagga caaacaaaag ggaaactcgg aaatacctat      1020
     gttcgaccgt tggttcaaaa agtcacgtat gaaaaactga ccaaatattt tgaagagaat      1080
     ccgcttcaag ccaaagcaat cgtccaaaaa gcgttaatgg cggcacgagg acgtgaagcg      1140
     gcgaaaaaag cgcgtgaatt gacccgccgc aaagatgcaa tgacggtcgg aacattaccg      1200
     ggtaaattgg ctgactgcca aagcaaagat ccggcaatca gcgaattgta tctggtggaa      1260
     ggggactcag cgggcggttc ggcgaaacag ggacgtgatc gtgtcttcca agcgattttg      1320
     ccgctcaaag gtaaaatttt gaacgttgaa aaagcgcgat tggacaaaat tctaaaatcc      1380
     gaagagatca ccaatatgat caccgctttg ggctgcggaa tcggtgaaga gttcaatgaa      1440
     gagaaacttc gctaccataa aatcatcatc atgaccgatg ccgacgtcga cggaagccat      1500
     atccaaacgc tgttattgac cttctttttc cgatatcttc cgaaaattgt cgaaaatgga      1560
     tacctctatt tggcacaacc gccgttgtat cgatacaaaa aagggaaaaa agagatctat      1620
     tttaaagatg accgtgttat gaacgctttc ttgatcgaga acggtattga agcgttagaa      1680
     gcggaaaatc tgaatgtcgg tgtaaatgat ctcgtctcat ttttcaaaat ggttgatcac      1740
     tatcgcagta cccttgatgc attggaacgc cgttatgctc ttgtggaact tatccgttat      1800
     ttcattgaaa atccggattt gatctcattg ccgcttacag agatgtatac caaagttgaa      1860
     gctttcttga cagctcaggg gaataatatc cttagtaaaa gcgtgagcga tgaagatatg      1920
     catctatttg tacaaaccaa agagggattg gaagagcttc acatcaatga tgagcttttt      1980
     gcttctccgc attttgccga agcaaactat attttccaaa aaattcagga ttggaatctt      2040
     cctctggaag gtgatttgct cgaattactc acccaaatta ccgattatgc gaaaaagggt      2100
     tcttacatcc agcgttacaa aggtctcggt gagatgaatc ctgaacagct ttgggaaaca      2160
     acgatgacac cggagaaccg cgtattgctc cgtatcacga tcgaagatgc ggaaaccgca      2220
     ggcgaatcgt ttaatctctt tatgggtgat gatgttgaac cgagacgtaa ttacatcgaa      2280
     acacacgcca aagatgttaa gcatctggat atctaa                                2316
//

If you have problems or comments...

PBIL Back to PBIL home page