(data stored in ACNUC7421 zone)

EMBL: CP002355.PE302

CP002355.PE302       Location/Qualifiers
FT   CDS_pept        complement(292374..292763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0303"
FT                   /product="protein of unknown function DUF180"
FT                   /note="COGs: COG1699 conserved hypothetical protein;
FT                   InterPro IPR003775; KEGG: hhe:HH0843 flagellar assembly
FT                   protein FliW; PFAM: protein of unknown function DUF180;
FT                   SPTR: Flagellar assembly factor fliW 1; PFAM: FliW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32970"
FT                   /db_xref="GOA:E4TYJ3"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ3"
FT                   /protein_id="ADR32970.1"
FT                   /translation="MQFDLKLPLLGFETVSKMELQKIDEIFFRLESIGEGPSFTLISPF
FT                   ALREYSFDIPSSLQALMGITPESNLLIYNIMILQTPIEKSTINFVAPLIFNTDNQTMAQ
FT                   IIVDNRSDFGIAEPIKNYLKSSTDE"
     atgcagtttg atttaaaact tcccctcctc ggctttgaaa cggtttcgaa aatggaactc        60
     caaaaaattg atgagatttt tttccgtctg gaaagcatag gcgaaggacc ttcttttacc       120
     cttatcagcc catttgcttt acgcgaatat tcttttgaca tcccctcttc tcttcaggcc       180
     ttaatgggaa tcacccctga aagcaatcta ctgatctata atattatgat cttgcaaacc       240
     ccgattgaaa aatcgacgat aaattttgtc gcccccttga ttttcaatac cgacaatcag       300
     actatggctc agatcattgt tgataaccgt tccgatttcg gaattgccga accgatcaaa       360
     aactatctca aaagttctac cgatgagtag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page