(data stored in ACNUC7421 zone)

EMBL: CP002355.PE303

CP002355.PE303       Location/Qualifiers
FT   CDS_pept        292897..293673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0304"
FT                   /product="outer membrane assembly lipoprotein YfiO"
FT                   /note="COGs: COG4105 DNA uptake lipoprotein; InterPro
FT                   IPR017689; KEGG: tdn:Suden_0413 DNA uptake
FT                   lipoprotein-like; SPTR: DNA uptake lipoprotein-like
FT                   protein; TIGRFAM: outer membrane assembly lipoprotein YfiO;
FT                   TIGRFAM: outer membrane assembly lipoprotein YfiO"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32971"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ4"
FT                   /protein_id="ADR32971.1"
FT                   /translation="MIRTWLIAITTLILLTGCGSKDLEEFNKPAEYWYEKMVTAVSNGN
FT                   LERADSYFSSLQSEHISSPFLSEATMIMAQAHMAHEEYLLSEHFLDEYIRRYATPEGRE
FT                   YAEFLKIKAKFLALPNPGRDQGLIDETLNSVETFKRSYPNSMYLPLVHSMETQLQLARG
FT                   VLNEQIAELYERLGKPKAAGSYRTIAPVTWIDSKNIVRAEVPWYREMFEGDGTSSWYAF
FT                   MIPKTRSVVSMDDNESTASPKKQDNGSWYDFLIPHF"
     atgattagaa catggttaat cgcaataacg acacttattc tgcttaccgg atgcggtagt        60
     aaagacctcg aagagtttaa taaacctgcg gaatattggt atgaaaagat ggtaacggcc       120
     gtttccaacg gtaatttgga aagagctgac agctatttta gttcactgca aagtgaacat       180
     atcagttcac cgtttttatc cgaagcaact atgattatgg cacaagcgca tatggcacat       240
     gaagagtatt tgttaagcga gcattttttg gatgaatata tccgccgtta tgccacccct       300
     gaagggcgtg aatatgctga atttttgaag attaaagcaa aattcttagc cctcccgaat       360
     ccgggacgcg atcaagggtt gatcgatgaa accttgaaca gcgttgaaac gtttaaaaga       420
     agttatccga actcaatgta tttgccgttg gttcattcga tggagacaca attacaactg       480
     gctcgaggag tccttaatga acaaattgca gagctctatg agcgtttggg aaaaccaaag       540
     gcggcaggct cttatcgtac aattgcaccg gtaacatgga ttgattctaa aaatatcgtc       600
     cgtgccgagg tcccttggta tcgggagatg tttgaagggg acggtaccag cagctggtat       660
     gcttttatga ttccgaaaac tcgcagcgtc gtctctatgg atgataatga gagtacggca       720
     tcaccgaaaa aacaagataa cggcagctgg tacgattttt tgattccaca tttctaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page