(data stored in ACNUC7421 zone)

EMBL: CP002355.PE304

CP002355.PE304       Location/Qualifiers
FT   CDS_pept        293717..296140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0305"
FT                   /product="ATP-dependent proteinase"
FT                   /EC_number="3.4.21.53"
FT                   /note="COGs: COG0466 ATP-dependent Lon protease;
FT                   InterProIPR004815: IPR003111: IPR003959: IPR001984: IPR
FT                   008268: IPR003593; KEGG: tdn:Suden_0414 peptidase S16,
FT                   ATP-dependent protease La; PFAM: AAA ATPase central domain
FT                   protein; peptidase S16 lon domain protein; PRIAM:
FT                   Endopeptidase La; SMART: peptidase S16 lon domain protein;
FT                   AAA ATPase; SPTR: ATP-dependent protease La; TIGRFAM:
FT                   ATP-dependent protease La; PFAM: ATP-dependent protease La
FT                   (LON) domain; ATPase family associated with various
FT                   cellular activities (AAA); Lon protease (S16) C-terminal
FT                   proteolytic domain; TIGRFAM: ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32972"
FT                   /db_xref="GOA:E4TYJ5"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ5"
FT                   /protein_id="ADR32972.1"
FT                   /translation="MQLSNYSSFPTNLPVIAEDELFLYPFMISPLFLNDEKNIAAAAEA
FT                   IENNSLVIVCPVKPEHEGEREGDSIYDAGVIGSIMRKVVLPDGRIKVLFQGLARGHITE
FT                   MIHENPLRAHVDLIQSTSVNELKMDAILEVLREKVRALSQVSNYFPPDLLRTIEENHEY
FT                   NRIVDLICSSIKIKKENAYQLFIERDPEKRFLMLIDELIEETEANKLQKEIRSKVHSRI
FT                   EKVNKEYFLKEQLKQIQKELGTDTHRDEEIEEFRKKLEAKKDKMHADAYKEINKQLERF
FT                   ARMHPDSADAGMIQTYLEWVLEIPYGEEAKKALNIHDVENQLNKDHFSLKKPKERILEF
FT                   FSVKELLELRGIADKEGRGAILCFAGPPGVGKTSLANSIATALKRPLVRIALGGLEDVN
FT                   ELRGHRRTYIGAMPGRIVQGVIEAKKMNPVIVLDEIDKVAKSHRGDPTAVLLEILDPEQ
FT                   NTHFRDYYLNFNLDLSKAIFIATANDVGQIPGPLRDRMEFISVSSYTPQEKFQIAKQYL
FT                   IPQELKKHGLKTSELSISKTALAEVIEKHTREAGVRNLRRRVADIVRKAAKKILEEPTT
FT                   QKVTVSLKNLKEFLEKTIFEIDRTDHVDRIGVVNGLAWTAVGGDVLKIEAIRINGKGVL
FT                   QLTGSLGDVMKESARIALSVVKTLIDEGKISVDHSIIPLSPAERESDVPVDASEVYKRF
FT                   DLHVHVPDGATPKDGPSAGIAMSTVIASILTNKKVRADIAMTGEVSLTGNVLPIGGLKE
FT                   KLIAAHRAGMKLALIPQKNYDRDLADIPDEVKGALEIVGVSRIEEVLERLLIDA"
     atgcaactta gtaattacag ctcttttcct actaatttac ctgttattgc ggaggatgaa        60
     ctttttctat acccgtttat gatttctcct cttttcttga acgatgaaaa gaatattgcg       120
     gcggctgccg aagcgatcga gaataattca ctcgtgatcg tttgccctgt gaagcctgaa       180
     catgaagggg aacgcgaagg tgattcgatc tatgatgcgg gggtcatcgg ctcaattatg       240
     cgtaaagtcg tattacccga cggtcgaatc aaagttctgt ttcagggatt ggctcgagga       300
     catattacag agatgataca tgaaaaccct ctgcgtgctc atgttgattt gattcaatcc       360
     acaagtgtga atgaacttaa aatggacgcc attttagaag tactgcgcga aaaagtgcgt       420
     gccctgtctc aggtgagtaa ctattttccc cctgatctgc tccgaacgat cgaagagaat       480
     catgagtaca accgtatcgt cgatttgatc tgcagttcga tcaagattaa aaaagagaat       540
     gcctatcagc tctttatcga acgcgatcct gaaaagcgtt ttttgatgct gatcgatgag       600
     ctgatcgaag agaccgaagc gaacaaactc caaaaagaga tccgttcaaa agtccattcg       660
     cgtatcgaaa aagtgaacaa agagtatttt ctcaaagagc agctcaagca gattcaaaaa       720
     gagttgggga ccgatactca ccgcgacgaa gagatcgaag aatttagaaa aaaactcgaa       780
     gccaaaaaag ataaaatgca cgctgatgcg tacaaagaga tcaacaaaca gctggagcgt       840
     tttgcgcgga tgcatccgga cagtgccgat gcggggatga ttcagacgta cctcgaatgg       900
     gtacttgaga ttccgtacgg cgaagaggcg aaaaaagcac ttaatattca cgatgtcgaa       960
     aatcagctca acaaagacca cttttcattg aaaaaaccga aagagcggat cttggaattt      1020
     ttctcggtca aagaactcct tgagcttcgc ggtattgccg ataaagaggg gcgcggtgcg      1080
     attctttgtt ttgcaggccc tccgggtgtc ggtaagacct cacttgccaa ctctattgca      1140
     acggcactta aacgtcccct tgtgcggatt gctttgggcg gattggaaga tgtgaacgaa      1200
     ttacgcgggc accgccgtac ctatatcggt gcgatgccgg ggcgcattgt tcaaggggta      1260
     atcgaagcta aaaagatgaa ccccgtcatc gtcctcgatg agatcgataa agtggcaaaa      1320
     tcgcatcgcg gcgatccgac ggcagtattg ctggagattc tcgatccgga acaaaatacc      1380
     catttcagag actattatct gaactttaac ctcgatcttt ccaaagcgat ttttatcgcg      1440
     acagcaaacg atgtaggtca gattcccggg ccgctacgcg atcgcatgga gtttatctcg      1500
     gtgagttcgt atacgccgca ggagaaattt cagattgcca aacagtatct gattcctcag      1560
     gaactgaaaa aacacggatt aaaaacctct gaactctcta tctcaaaaac ggcattagcc      1620
     gaagtgatcg agaaacatac ccgtgaagcg ggggttcgta accttcgccg ccgtgtcgcc      1680
     gatatcgtcc gtaaagcggc gaaaaagatt ctcgaagagc cgacgaccca aaaagtaacg      1740
     gtgagtttga aaaatcttaa agagttttta gaaaaaacga tatttgagat cgaccgtacc      1800
     gatcatgtcg atcgaatcgg tgtagtaaac ggtctagcct ggacggctgt cgggggtgat      1860
     gtacttaaaa tcgaagcgat ccgtatcaac ggcaaagggg tattgcagct gacgggaagt      1920
     ttgggagatg tgatgaaaga gtctgcccgt atcgccctct ctgtcgttaa aaccttgatc      1980
     gatgagggga aaatcagtgt cgatcactcg attatccctc ttagtcctgc ggagcgagag      2040
     agtgatgttc cggttgatgc aagcgaggtc tataaacgct ttgacttgca tgtccacgtt      2100
     cccgacgggg ctacccctaa agacggcccg agtgcgggga ttgcaatgtc caccgtcatc      2160
     gcatcaattt tgaccaataa aaaagtacgt gccgatatcg cgatgacagg ggaagtttca      2220
     ttgaccggaa atgttcttcc gatcggcggg ctcaaagaga agctgattgc cgctcatcgt      2280
     gccgggatga agctagccct tatccctcag aaaaattatg atcgcgatct agccgatatt      2340
     cccgacgagg ttaaaggggc tttggaaatc gtcggcgtca gtcggatcga agaagttctt      2400
     gagcgccttt taattgacgc ataa                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page