(data stored in ACNUC7421 zone)

EMBL: CP002355.PE305

CP002355.PE305       Location/Qualifiers
FT   CDS_pept        complement(296094..297110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0306"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COGs: COG0037 ATPase of the PP-loop superfamily
FT                   protein implicated in cell cycle control; InterPro
FT                   IPR012795: IPR011063; KEGG: tdn:Suden_1738
FT                   tRNA(Ile)-lysidine synthetase-like; PFAM: PP-loop domain
FT                   protein; SPTR: tRNA(Ile)-lysidine synthetase-like protein;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   family; TIGRFAM: tRNA(Ile)-lysidine synthetase, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32973"
FT                   /db_xref="GOA:E4TYJ6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ6"
FT                   /protein_id="ADR32973.1"
FT                   /translation="MSKLLHLDRLREGRVLLAFSGGVDSTALFHLLLENNIAFDIAHVN
FT                   YHTRETSDAEEKNAERLAARHSLQCYAHSCRLGGINFEHRAREERYRFFGYLMKKHGYT
FT                   YLLTAHQLNDRLEWLMMQICRGSGLPEMLGIRSHDSRDGIEILRPLLEWDRDSIEAYLH
FT                   ERKIPHHIDESNADERYTRNFFRHRYSTPIMRDYRDAIRRSFRYLEEDSESLIESMDFK
FT                   TVNEFAYAENPTNIRSLLYGIDRYFKSRSYLLSKHDKEALKGGGDHIIGRRFIVSIEMK
FT                   YTFVAPYEANVVMDKGFKEECRKLKIATKLRGYLFGVPEAMRVMRQLKGAQELLRSD"
     atgtctaaac ttctccacct tgatcgatta cgcgagggga gagtcctcct cgcattctcc        60
     gggggggtcg attccaccgc cctttttcac cttttactcg aaaataatat cgcttttgat       120
     attgctcacg tcaactatca cacacgagaa acaagcgatg ccgaagaaaa aaatgccgaa       180
     cgactcgcag cacgacattc tcttcaatgc tatgcccatt cctgccggct aggggggatc       240
     aatttcgaac atcgcgcccg agaagaacgg taccgttttt tcggctatct gatgaaaaag       300
     catggctata cctatcttct caccgcccat cagctcaatg atcgtttgga atggctgatg       360
     atgcaaattt gccgaggttc aggcttgcct gaaatgctcg gcatacgttc ccatgactca       420
     cgtgacggga tagaaatttt acgccctctt ttggaatggg accgcgactc cattgaagcc       480
     tatctgcatg aacgcaaaat tcctcatcat attgatgaga gcaatgcgga tgaacgctat       540
     acccgcaatt tttttcgtca ccgctacagc actccgataa tgcgcgacta ccgtgacgcc       600
     atccgacgaa gcttccgata tttggaagag gacagtgaat cgttgatcga atcgatggat       660
     ttcaaaacgg tgaatgaatt tgcgtatgcc gaaaatccca caaatatccg atcacttctc       720
     tatgggattg accgctattt taaatcccgc agttatctgc tcagcaagca cgataaagag       780
     gcgttaaagg gggggggaga tcacatcatc ggaagacgat ttatcgtctc tatcgaaatg       840
     aagtatacgt ttgtcgcccc ctatgaggcc aatgtcgtca tggataaagg gtttaaagaa       900
     gagtgcagga aactaaaaat cgcaaccaaa ctgcgagggt accttttcgg tgtccccgaa       960
     gccatgcgtg ttatgcgtca attaaaaggc gctcaagaac ttcttcgatc cgactga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page