(data stored in ACNUC7421 zone)

EMBL: CP002355.PE306

CP002355.PE306       Location/Qualifiers
FT   CDS_pept        complement(297103..298419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0307"
FT                   /product="SSU ribosomal protein S12P methylthiotransferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="COGs: COG0621 2-methylthioadenine synthetase;
FT                   InterProIPR005839: IPR005840: IPR013848: IPR007197: IPR
FT                   020612: IPR006638; KEGG: tdn:Suden_1737 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0004; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   SPTR: MiaB-like tRNA modifying enzyme YliG, TIGR01125;
FT                   TIGRFAM: MiaB-like tRNA modifying enzyme YliG; RNA
FT                   modification enzyme, MiaB family; PFAM: Radical SAM
FT                   superfamily; Uncharacterized protein family UPF0004;
FT                   TIGRFAM: MiaB-like tRNA modifying enzyme YliG, TIGR01125;
FT                   RNA modification enzyme, MiaB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32974"
FT                   /db_xref="GOA:E4TYJ7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ7"
FT                   /protein_id="ADR32974.1"
FT                   /translation="MSKKLHIVSLGCTKNLVDTEVMLGRLKDFEMTDASGEADVIIVNT
FT                   CGFIDAAKQESLNTIFNLDAGRKKDSVLVMAGCLSERYKEELSKELSEVDIFTGVGDYD
FT                   KIDELLAAKQSRFTPEVYLIDGAERVVTGSTYHAYIKLSEGCNQQCSFCAIPSFKGKLN
FT                   SRNLESIAHEVETLVAKGYYDFSFVSQDSSSYLRDQNIQDGLIHLIKRIELIDGVKSAR
FT                   ILYLYPSTTSLKLIKAIGDSKVFHNYFDMPIQHINDEMLKIMKRGFGKAKTLELLGAMK
FT                   ALPNAFIRTSFIVGHPQETEAMFEEMAEFSATFGFDRLNVFSYSDEEGTSAYTMEEKIP
FT                   SKTINARAKKLGKIASDVELSSLQKLVGTEITLVIDGESDEHEFLLSARALNWAPDVDG
FT                   EIYVNDREIEGELAFGKMYRARITELAEKRPLATVTGNV"
     atgtccaaaa aacttcacat cgtgtcactc ggttgcacca aaaatctcgt cgataccgag        60
     gtaatgcttg ggcgtctcaa agatttcgaa atgaccgatg cgagcggtga ggcggatgtc       120
     atcatcgtca atacgtgcgg atttatcgat gcggccaaac aagaatcgct caatacaatt       180
     ttcaatctcg atgcgggacg taaaaaagat tccgtacttg tcatggcggg atgcctctct       240
     gaacgttaca aagaggagct ttccaaagaa ctcagcgaag tggacatctt tacgggtgtc       300
     ggcgattatg acaaaatcga tgaattactc gccgcgaaac agagccgttt taccccagag       360
     gtttatttga tagatggagc agagcgggtt gtgacaggat cgacgtacca cgcctatatc       420
     aaactaagcg aggggtgtaa tcagcaatgc agcttctgcg ctatcccctc gttcaaagga       480
     aaactcaatt cccgtaattt ggagagcatc gcccatgaag tcgaaaccct tgtcgccaaa       540
     gggtactatg atttcagctt cgtttctcaa gactccagtt cgtatctgcg cgatcaaaac       600
     attcaagacg gacttatcca tctgattaag agaatcgagc tgatcgacgg tgtcaaaagc       660
     gcccgtattt tgtatctgta cccttcgaca acatcattga aactgatcaa agcaatcggg       720
     gattcgaaag tgttccataa ctacttcgat atgccgatcc agcacatcaa cgacgagatg       780
     ctgaaaatca tgaaacgggg attcggaaaa gccaaaacac ttgagcttct gggtgccatg       840
     aaagcattgc caaatgcctt tatccgtacc agtttcatcg tcgggcatcc gcaggaaaca       900
     gaagccatgt tcgaagagat ggcggagttt tcggcaacgt ttggatttga ccgtcttaat       960
     gtcttcagct actccgatga ggaggggacg agcgcttata cgatggaaga gaaaatccct      1020
     tccaaaacca tcaacgcacg tgccaaaaaa ctggggaaaa ttgcttcgga tgttgagctg      1080
     tccagtctgc aaaagttggt cggaacagaa attacacttg ttatcgatgg agagagtgac      1140
     gaacacgaat tcctcctcag cgcccgcgcc ctcaattggg cacccgatgt cgacggtgag      1200
     atctatgtca atgaccgcga aatcgaaggt gaactggcct ttggaaaaat gtatcgtgcc      1260
     cgcatcaccg aactcgccga aaaacggcct ctggctaccg taacgggaaa tgtctaa         1317
//

If you have problems or comments...

PBIL Back to PBIL home page