(data stored in ACNUC7421 zone)

EMBL: CP002355.PE307

CP002355.PE307       Location/Qualifiers
FT   CDS_pept        298471..299397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0308"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="COGs: COG2041 Sulfite oxidase; InterPro IPR000572;
FT                   KEGG: mca:MCA0844 putative sulfite oxidase subunit YedY;
FT                   PFAM: oxidoreductase molybdopterin binding; SPTR: Sulfoxide
FT                   reductase catalytic subunit yedY; PFAM: Oxidoreductase
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32975"
FT                   /db_xref="GOA:E4TYJ8"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ8"
FT                   /protein_id="ADR32975.1"
FT                   /translation="MLRRDNYDLIHSSEITSEAVYHERRALMKLGASAALLGASPLMAA
FT                   LGFEKSKSKSTLELTPYDQVITYNNFYEYGTDKESPAKLSKNLKTRPWTLSVGGEVQKG
FT                   RTYDIDELIKKIPLEERIYRFRCVEGWSMVVPWVGFSLSSLLKAAGLTSKSKYVEFETL
FT                   FDPAQFPGQKQSFGTIPFPYREGLRIDEAMHPLTILAVGLYGKELLPQNGAPIRLVVPW
FT                   KYGFKSIKSIVKITLSEHQTRSTWNQIAPSEYGFYANVNPLVDHPRWSQKRERVLGKFF
FT                   KQDTLAFNGYANDVAYLYKNMDLKKFY"
     atgcttagac gagataatta cgatttgatc cattcctccg agattacctc cgaagcggtc        60
     tatcatgagc gaagagcctt aatgaaatta ggggcatcag ccgcattgct cggagcatca       120
     ccgctgatgg cggcattagg gtttgaaaaa tccaaaagca aaagtacgct ggaattgaca       180
     ccttatgatc aggttatcac ctacaataat ttttatgagt acggaaccga taaagagtcc       240
     cccgccaagc tgtccaaaaa tcttaaaacc cgtccgtgga cactcagtgt cggcggagag       300
     gtacaaaagg ggcgtacgta cgatatcgat gagctgataa aaaagatacc gcttgaggag       360
     cggatttatc gtttccgctg tgttgagggg tggtcaatgg tcgtgccatg ggtcggtttc       420
     agcctctcat cgttgctgaa agctgcggga ttgacatcaa aaagcaaata cgttgaattt       480
     gagacactct ttgaccccgc ccagtttccc ggacaaaaac aaagttttgg tactataccg       540
     tttccatacc gcgaggggct tcggatcgat gaagcgatgc atcctctgac gatcttggcg       600
     gtcgggcttt acggcaaaga gcttttgccg caaaacggtg ctccgatccg tttggtcgtc       660
     ccgtggaaat acgggtttaa aagtatcaaa agcattgtaa aaatcaccct tagcgaacat       720
     caaacccgtt cgacctggaa ccaaatcgct ccgagtgagt acgggtttta tgccaacgtc       780
     aatcccttag tcgatcatcc gagatggtcg caaaagagag agcgggtact ggggaaattt       840
     tttaagcagg atacattagc ttttaacggc tatgcaaatg atgtggcata tttgtataaa       900
     aatatggatt tgaaaaagtt ttattaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page