(data stored in ACNUC7421 zone)

EMBL: CP002355.PE308

CP002355.PE308       Location/Qualifiers
FT   CDS_pept        299410..300012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0309"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="COGs: COG2717 membrane protein; InterPro IPR013130;
FT                   KEGG: abu:Abu_0562 hypothetical protein; PFAM: Ferric
FT                   reductase domain protein transmembrane component domain;
FT                   SPTR: Conserved hypothetical membrane protein; PFAM: Ferric
FT                   reductase like transmembrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32976"
FT                   /db_xref="GOA:E4TYJ9"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYJ9"
FT                   /protein_id="ADR32976.1"
FT                   /translation="MRIIIWIGALLPIVFALFRFSAAFHPVWLNDILLFIEGYVHLSLT
FT                   KFPNDPLKFLINLSGESALWLLALSLTITPLRSYLKINLFSYRRLLGLFAFFYALIHAL
FT                   LFIGIDQQFDFDGLIHEVTTKPFIAFGMGAFLILLLMALTSTKKLFSNFKGWHRLVYIA
FT                   VVLIVVHYLMSHKTITWDNLSTAGVLIFLLVLRLIKR"
     atgagaatta tcatttggat cggagcactg cttccgattg tttttgcact gtttcgtttt        60
     agcgcagcgt ttcatccggt gtggctcaat gacattttac tttttatcga aggatatgtg       120
     catctgagtt tgacaaaatt ccctaacgat ccgttaaaat ttttaatcaa tctcagcgga       180
     gagagtgcat tatggctgct ggcactatca ttaacgatta ctccgctgcg aagctatttg       240
     aaaatcaatc tcttttcata ccgtcgtctt ttggggctgt tcgccttttt ttacgcgttg       300
     attcatgcac tgctttttat cggaattgat cagcagtttg atttcgatgg cctgattcat       360
     gaagtgacga caaagccgtt tatcgctttt ggaatggggg catttctcat ccttttgttg       420
     atggcgctta cgtcgacgaa aaaacttttt tcaaatttca aagggtggca tagactcgtc       480
     tatattgcag tcgtattgat tgtagtccac tatctgatga gccacaaaac gatcacttgg       540
     gataacctct caacagcagg agttctgata tttttactgg tattgcggct gattaaacga       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page