(data stored in ACNUC7421 zone)

EMBL: CP002355.PE309

CP002355.PE309       Location/Qualifiers
FT   CDS_pept        300009..301154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0310"
FT                   /product="HI0933 family protein"
FT                   /note="COGs: COG2081 flavoprotein; InterPro IPR004792:
FT                   IPR013027; KEGG: tdn:Suden_1736 HI0933-like protein; PFAM:
FT                   HI0933 family protein; SPTR: HI0933-like protein; PFAM:
FT                   HI0933-like protein; TIGRFAM: flavoprotein, HI0933 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32977"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK0"
FT                   /protein_id="ADR32977.1"
FT                   /translation="MKHYDVIILGAGASGLMCAAQLRQNSSLSIAIIEGNNRPALKLKA
FT                   SGGGKCNLTNVEVDETHFLGDERLVLSALSTFSQKKLLDYFKAGGLRPVIRKERYYFCP
FT                   KSSDEVISILLGKAAGTDLLLGHKILSVEGKNPFVVTTDKGKFQACRVVVATGGASYKE
FT                   LGASDIGLKIAQHYDIKTIPFSPALVGLTLQPKEFWMKELSGISFPARIHVAGKTLDED
FT                   LLFAHKGISGLVVLSASLYWHRGEIVIDFLPDFELNTLKYEKKSVSTAIPLPKRFMKAF
FT                   LEAVGLEDKACNRLDSQDWEKLIRIRQYAMAPSGTFGFSKAEACRGGVACEEIDPLTME
FT                   STKIKGLYFIGETVDVTGELGGYNFQWAFSSAVVCSISVML"
     atgaaacact acgatgttat cattttagga gccggggcga gcgggttgat gtgtgcagcg        60
     caactccgtc aaaacagctc cctgtctatc gccatcatcg aggggaataa ccgtcctgcc       120
     ctgaagctta aagccagcgg cggtggcaaa tgcaatctga cgaatgtcga agtggatgag       180
     acccattttc tcggcgatga gagattggtc ttgagtgctt tgtcgacttt ttcgcaaaaa       240
     aaacttttgg actatttcaa agcaggcgga ttacgtcccg taatccgaaa agagcggtac       300
     tatttttgcc cgaaaagttc cgatgaggtg atctccattt tactgggcaa agctgccggg       360
     accgatttat tattggggca taaaattctt tccgtagagg ggaaaaatcc ttttgtcgtt       420
     acgaccgata aaggaaaatt tcaagcctgc cgtgtggttg ttgcaacggg gggagcgagc       480
     tataaagagc tcggagcgag cgatatcggg ttgaaaatcg cacagcatta cgatattaaa       540
     acaatacctt tttctccggc attagtggga ctgacactgc agccgaaaga gttttggatg       600
     aaagagctca gcgggatcag tttcccagcc cgcatccatg tagcgggaaa aacactcgat       660
     gaagatttgc tctttgcgca caaagggatc agcggactgg ttgtcctttc ggcatcgctg       720
     tattggcata gaggggaaat cgtgatcgat tttctccccg atttcgaact aaacaccctg       780
     aaatatgaga aaaaaagtgt ctctacggca atccctcttc cgaaacggtt tatgaaagcc       840
     tttttggaag ctgtgggatt ggaagataaa gcgtgcaacc gtttggattc acaagattgg       900
     gaaaaactga tccgtatccg tcagtatgcg atggctccct cggggacatt cggattttca       960
     aaagctgaag cgtgccgagg cggggtagcg tgcgaggaga tcgatccttt aacaatggag      1020
     agtaccaaaa tcaaagggct ctattttatc ggtgaaacag tcgacgtgac gggagagtta      1080
     ggaggctata attttcaatg ggcgttcagt tcggcggtag tctgctccat ttccgttatg      1140
     ctataa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page