(data stored in ACNUC7421 zone)

EMBL: CP002355.PE31

CP002355.PE31        Location/Qualifiers
FT   CDS_pept        complement(32122..32835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0031"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: ant:Arnit_1847 ABC
FT                   transporter-like protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: ABC transporter related protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32699"
FT                   /db_xref="GOA:E4TW83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW83"
FT                   /protein_id="ADR32699.1"
FT                   /translation="MLHVADLTCQILKNVSFALEEGKNLTILGNNGSGKTTLARALCHL
FT                   IPSESVFWEGKKIGDIAHHLRSQTINYVPTSLEIYDEYLSVTDYLDLNFFESSNPQMRE
FT                   EILGVMEIEHLRDSPCQRLSSGESSLLLIAGAILHRAAYTILDEPTANLDQAKKVKIYR
FT                   LLKSGSYFQNKIIITHDLNLAYKLGYDILYLEEGEVRFFGSCSDFFDPTQLEGCFGSAV
FT                   QNIGGNFVVNYDEVR"
     atgctgcacg tcgctgatct cacctgccaa attttgaaaa atgtcagttt cgccctcgaa        60
     gaggggaaaa atttgacaat tttaggaaat aacggaagcg ggaaaacgac gctggccaga       120
     gcactctgtc atctaatccc ttccgaaagt gttttttggg aggggaaaaa gataggtgat       180
     attgcacatc acctgcgttc acagacgatt aactacgttc cgacatcgct tgaaatttat       240
     gatgaatatt tgagcgtaac cgattatctg gacctcaatt ttttcgaatc ttccaaccct       300
     caaatgaggg aagagattct tggagtgatg gagatagaac acctcagaga ctccccctgc       360
     cagaggctca gcagcggcga gtcctcgctt ctcttgatag ccggcgcaat tttgcaccgt       420
     gctgcgtaca caattctcga tgagccgacc gccaatctcg atcaggcaaa aaaggtcaaa       480
     atttaccgcc tcctcaaaag cggctcctat tttcaaaaca agatcatcat tacccatgat       540
     ctgaatttgg cttacaagct tggatatgac attttgtatc tggaagaggg ggaagtccgg       600
     tttttcggat cgtgcagtga ttttttcgat ccgacccagc ttgagggctg tttcggaagc       660
     gcagttcaaa atatcggcgg aaactttgtg gtgaattatg atgaagtacg ttag             714
//

If you have problems or comments...

PBIL Back to PBIL home page