(data stored in ACNUC7421 zone)

EMBL: CP002355.PE310

CP002355.PE310       Location/Qualifiers
FT   CDS_pept        301190..302419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0311"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027: IPR000103; KEGG:
FT                   tdn:Suden_1213 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32978"
FT                   /db_xref="GOA:E4TYK1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK1"
FT                   /protein_id="ADR32978.1"
FT                   /translation="MKRQRVVIVGGGYAGVKALQTLAPSGQCDIVLIDQHPYHYLQTEA
FT                   YELIANECSMTRVTIDLVALCLSYGEHVTFIKDTIREIDFEHKCAGGQSSCHPYDYLLL
FT                   CSGSRTAFHTSVPGLREHSHGVKTLPSALAFKHQFEQRLYDRMESEGGWCSEPFNVVIG
FT                   GGGLSGVEIAAEMANYIRVFHLDNTLTCDNIHIFLIIPHENVLEGMEPYLIQKATERLT
FT                   RLGVKIIRHSRITSVEEHTLILNNEESICFDFMIFTGGIIASTLTTTIESEKNKKSQLI
FT                   IDEYLRVPLYEGVFAAGDIAEIRSTDGKILPPTAQIAEQSGTEAGKNILALIEGREMDR
FT                   VSMKIEGMMVALGGKYAAISLFGRIRFSGFAGYLIKTVIMRGYRYLLHRQCTKGMDGLS
FT                   KTKAQCHTGF"
     atgaaacgtc agcgcgtcgt tatcgtaggc gggggatatg cgggggtaaa agcactccaa        60
     acattggccc cttccggtca gtgtgatatt gttctgatcg atcagcaccc ctatcattat       120
     cttcaaaccg aagcatatga acttatcgcc aatgaatgca gtatgacccg tgttacgatc       180
     gacttggtcg cgttgtgtct gagctacggc gagcacgtaa cgtttatcaa agatacgata       240
     cgcgaaatcg attttgaaca caaatgtgcc ggcggacaaa gttcttgcca cccgtatgat       300
     tatctcctcc tctgcagtgg aagccgtacc gcttttcaca cttcggtacc ggggctgcgt       360
     gaacattccc acggtgtaaa aacattgccg agtgcccttg cctttaagca tcagtttgag       420
     cagcgtctgt atgatcgaat ggaaagcgag gggggatggt gcagcgaacc ctttaatgtg       480
     gtgatcgggg gagggggact gagcggcgtc gagattgcgg cggagatggc aaattatatt       540
     cgtgtttttc atctggacaa tacccttacc tgcgataata ttcatatctt tttgattatc       600
     cctcatgaaa atgttttgga ggggatggaa ccttatctca tccaaaaagc gacagagcgt       660
     ttgacccggc tcggggtaaa aatcattaga cattcccgta ttacttcggt ggaagagcat       720
     acgttgattt taaacaacga ggagagcatt tgtttcgatt ttatgatttt tacgggaggg       780
     attatcgcat cgacattgac gacgacgata gagagcgaaa aaaacaaaaa gtcgcagctc       840
     attatcgatg agtatcttcg cgttccgttg tacgaggggg tatttgccgc cggcgatatt       900
     gccgaaatac gaagtacgga cggaaagatt cttcccccta cggcacagat cgccgaacaa       960
     agcggaaccg aagcgggaaa aaatatccta gcactgatcg aggggcggga aatggaccgt      1020
     gtatcgatga aaattgaggg gatgatggtc gctttggggg gaaaatatgc cgcaatttct      1080
     ctttttggac ggattcgttt cagtggattt gcggggtacc ttatcaaaac ggtaattatg      1140
     agagggtacc gttatcttct ccatcgtcaa tgtaccaaag ggatggatgg actctctaaa      1200
     actaaagcac aatgccacac gggattttaa                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page