(data stored in ACNUC7421 zone)

EMBL: CP002355.PE313

CP002355.PE313       Location/Qualifiers
FT   CDS_pept        303740..304138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0314"
FT                   /product="NusB antitermination factor"
FT                   /note="COGs: COG0781 Transcription termination factor;
FT                   InterPro IPR011605: IPR006027; KEGG: tdn:Suden_0403
FT                   transcription antitermination protein NusB; PFAM:
FT                   NusB/RsmB/TIM44; SPTR: N utilization substance protein B
FT                   homolog; TIGRFAM: transcription antitermination factor
FT                   NusB; PFAM: NusB family; TIGRFAM: transcription
FT                   antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32981"
FT                   /db_xref="GOA:E4TYK4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK4"
FT                   /protein_id="ADR32981.1"
FT                   /translation="MATRHQARMAVVSLLYAYDLGNQTIADFSDEILEEKKIRNKQRDF
FT                   ALDLFKGVTEHLSEIDEAIVKHLKDWDFDRLGSIERATLRLGGYEIMFGELDSAVIINE
FT                   AIEVAKAFGSEQSPKFINGVLDAISKDK"
     atggcgacgc gtcatcaagc ccgcatggcg gttgtcagtc ttttgtacgc atacgatttg        60
     gggaatcaaa cgattgccga cttcagtgat gagattctcg aagaaaaaaa gatccgtaac       120
     aaacaacgtg attttgccct cgatttattc aaaggggtaa cggaacacct ttcagagatc       180
     gatgaagcga ttgtaaaaca cctcaaagac tgggattttg atcgtttggg ttcgattgag       240
     agggcgactc ttcgcttggg cggttatgaa attatgttcg gtgaactcga ttcggcggta       300
     attatcaatg aagcgatcga agtggctaaa gcgttcggaa gcgaacaatc acctaagttt       360
     attaacggcg ttttagacgc tatttcgaaa gacaaataa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page