(data stored in ACNUC7421 zone)

EMBL: CP002355.PE314

CP002355.PE314       Location/Qualifiers
FT   CDS_pept        304145..305191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0315"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
FT                   InterPro IPR020050: IPR007197: IPR005244; KEGG:
FT                   tdn:Suden_0404 hypothetical protein; PFAM: Radical SAM
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: Radical SAM superfamily; TIGRFAM: radical SAM domain
FT                   protein, CofH subfamily; menaquinone biosynthesis protein,
FT                   SCO4550 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32982"
FT                   /db_xref="GOA:E4TYK5"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK5"
FT                   /protein_id="ADR32982.1"
FT                   /translation="MRLSKEQALELIRHGDLKELGRMATARKKELHPDGITTFVVDRNI
FT                   NYTNVCWVDCKFCAFYRHGKDEDAYVLTFEEIDQKIEELLEIGGTQILFQGGVHPKLKI
FT                   EWYEDLVEHIHTKYPQITIHGFSSIELDFIAKVSHITIQECLSRLHAKGLASIPGAGAE
FT                   ILSDRVRDIIAPKKMDSLDWVDVHRQAHKLGIKSTATMMYGTVETDEEIIEHWNLIRNL
FT                   QDETGGFRAFIMWSFQGQNTQLMEEHPEIEKQSSNRYLRLLAVARLYLDNFPNIQSSWV
FT                   TQGPYIGQMALLFGANDLGSTMMEENVVRSAGAGFRMAKEEMIRLIRDIGETPAIRNTA
FT                   YEILEKFE"
     atgcgcctta gtaaagaaca agccttagaa cttatccgtc acggggattt aaaagaactc        60
     ggccgtatgg cgacggctcg caaaaaagag cttcacccgg acggtattac gacgttcgtc       120
     gtcgatcgta acatcaacta tacgaatgtc tgctgggtcg actgcaaatt ttgcgccttt       180
     tatcgccacg gaaaagatga agacgcttat gttcttacgt ttgaagagat cgatcaaaag       240
     atcgaagaac ttctcgaaat cggcggaacc cagattttgt ttcaaggggg cgttcacccg       300
     aagctaaaaa tcgaatggta tgaggatctg gtagagcata tccataccaa ataccctcaa       360
     atcactatcc acggattttc ttcgatcgag cttgatttta tcgccaaagt ttcccatatc       420
     accattcagg agtgtctttc acgccttcat gccaaaggat tagcctccat tccgggtgcg       480
     ggagccgaga ttctcagcga ccgagtacgc gatattatcg ctccgaaaaa aatggattcg       540
     ctagattggg tggatgtcca ccgccaggcg cataagctgg gtattaaatc gacggcgacg       600
     atgatgtatg gaacggtcga gaccgatgaa gagattatcg agcattggaa tttgattcgt       660
     aatcttcagg atgagaccgg aggattccgc gcttttatca tgtggtcgtt tcagggacaa       720
     aatacccaat tgatggagga acatccggaa attgagaaac aatccagcaa ccgctatctc       780
     agactgttag cggttgcacg cctttatttg gataacttcc cgaacatcca aagttcttgg       840
     gtgacgcagg ggccttatat cgggcaaatg gcacttttgt tcggtgcaaa cgatctgggt       900
     tcgacgatga tggaagagaa tgtcgtccgc agtgcggggg cagggtttcg gatggcgaaa       960
     gaggagatga ttcgacttat ccgtgatatc ggagagactc ccgcaattcg taacacggcg      1020
     tatgagattt tggaaaaatt tgagtga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page