(data stored in ACNUC7421 zone)

EMBL: CP002355.PE316

CP002355.PE316       Location/Qualifiers
FT   CDS_pept        306557..308344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0317"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="COGs: COG1200 RecG-like helicase; InterPro
FT                   IPR011545: IPR001650: IPR014001: IPR014021; KEGG:
FT                   tdn:Suden_0406 ATP-dependent DNA helicase RecG; PFAM:
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; SPTR: ATP-dependent DNA helicase; PFAM: Helicase
FT                   conserved C-terminal domain; DEAD/DEAH box helicase;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32984"
FT                   /db_xref="GOA:E4TYK7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK7"
FT                   /protein_id="ADR32984.1"
FT                   /translation="MLLLPSEDAEKFHRLGVGSVTALSLIAPASFEDRRLSHELFHNAS
FT                   CVIDARVEHVVRTPKTLKITFFAHNLECVIEGVIFHPKPYMLHQFPKHERAFYIGKAQW
FT                   ELGKWTIVHPVKISAVGSLVPIYKTPLRADVMRRLILKYVSVENLIADGLPEKIASELY
FT                   GIHFPDIPKALSEVQTYALKFAELFEYMRRLRLKRRYHKTSYRALGDVKKWIKTLPFAL
FT                   TTDQQNAIADIGSDLRGENAARRMIVGDVGSGKTMVILASVILMHPYRSILMAPTTILA
FT                   AQLYEEAQKYLPNLRIALVTNATKKAPLEEFDFIIGTHALLHRPLPEAGLVMVDEQHRF
FT                   GTAQRHALTRLTDNDTSPHYLQFSATPIPRTQAMIDSAHIDVSLIVQTPFTKNIMTRII
FT                   HKSDFSALLDHIRSEIKQNHQVLIVYPLVEQSEMIDYQSIDEARGYWEKNFENVYVTHG
FT                   KDKEKEAVLMAFREKGAILLATTVVEVGISLPRLSTVVIVGAERLGLSTLHQLRGRVSR
FT                   TGLQGYCYLYTNKSGKNERLESFSRCNSGFEIAALDLKFRSSGDLLDGSIQSGKAFRWA
FT                   DIAEDEKIVREVKSWLDKN"
     atgctattgt taccaagtga ggacgctgaa aagtttcacc gcttaggggt aggaagtgtt        60
     acggcactct ctctgatcgc ccccgcttct tttgaagatc gccgtctcag tcatgaactc       120
     tttcataacg cttcatgcgt catcgatgcg agggtagagc atgttgtccg cacccccaaa       180
     acccttaaaa tcactttttt tgcccataat ctggagtgtg tgatcgaagg ggtaattttt       240
     caccccaagc cctatatgct ccatcaattc cctaagcacg aacgtgcttt ttacatcggc       300
     aaagctcagt gggaactggg aaaatggacg atcgtccatc cggtgaagat cagcgccgta       360
     ggttccctcg tcccgatcta taaaacgcct cttcgcgccg atgtgatgcg tcgtttgatt       420
     ctgaaatacg ttagcgttga aaatctcatc gctgacgggc ttccggagaa aatagccagt       480
     gagctttacg gtatccattt tcccgacatc ccaaaagctt tgagtgaagt gcagacgtat       540
     gcccttaaat ttgccgaact gtttgaatat atgcgccgtc tccgtctcaa acgccgttat       600
     cacaaaacgt cgtatcgcgc tctcggcgat gtgaaaaagt ggataaaaac actcccgttt       660
     gcactcacaa cggatcagca aaatgcgata gcggatatag gatctgattt acggggcgaa       720
     aatgcggcac gccggatgat cgtcggggat gtcggatcgg ggaaaacaat ggttattctg       780
     gcttcggtca ttttgatgca cccctatcgc tctattttga tggcaccgac gacgattctt       840
     gccgcacagc tgtatgagga ggcgcaaaaa tacctgccga atctgcggat tgctctcgtc       900
     accaatgcca cgaaaaaagc tccgttggag gagtttgatt ttatcatcgg tactcacgca       960
     ctacttcatc gcccgctccc tgaagcgggt ctcgtaatgg tggatgaaca gcaccgtttc      1020
     ggcaccgctc agcgccatgc ccttacccgc ctcaccgata acgacacctc gccgcactat      1080
     ctgcaatttt ccgccacccc gattccccgt acgcaggcga tgatcgactc ggcgcatatc      1140
     gacgtgagtt tgatcgtcca gacaccgttt acaaaaaata tcatgacccg catcattcat      1200
     aaaagcgatt tttccgcttt gttggatcat atccgatccg agataaagca aaatcaccaa      1260
     gttctcatcg tctatccgct ggtagaacag agcgaaatga tcgattatca aagtattgac      1320
     gaagcacggg gatattggga aaagaatttc gagaatgtct acgttaccca cggcaaagac      1380
     aaggaaaaag aggcggtttt gatggcattt cgcgagaagg gggctattct tttggctaca      1440
     acggtcgtcg aagtggggat ctcgcttccg cgcctttcta cggtcgtaat cgtcggggcg      1500
     gagcgtttag ggctatcgac gcttcatcag ctgcgcggac gggtgagccg taccggattg      1560
     caggggtatt gttatctcta taccaataaa agcggaaaga atgagagact agaatcattt      1620
     agcagatgta acagcggttt tgagattgcg gcactcgatt tgaaattccg ctcaagcggc      1680
     gatttgctgg atggaagcat ccaaagcggt aaagcgttcc ggtgggcgga tattgctgaa      1740
     gatgagaaaa tagttcgaga agtgaaaagt tggctagata aaaattaa                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page