(data stored in ACNUC7421 zone)

EMBL: CP002355.PE317

CP002355.PE317       Location/Qualifiers
FT   CDS_pept        complement(308463..308999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0318"
FT                   /product="SSU ribosomal protein S30P;sigma 54 modulation
FT                   protein"
FT                   /note="COGs: COG1544 Ribosome-associated protein Y
FT                   (PSrp-1); InterPro IPR003489; KEGG: tdn:Suden_0407 sigma 54
FT                   modulation protein/ribosomal protein S30EA; PFAM: sigma 54
FT                   modulation protein/ribosomal protein S30EA; SPTR: SSU
FT                   ribosomal protein S30P / sigma 54 modulation protein;
FT                   TIGRFAM: ribosomal subunit interface protein; PFAM: Sigma
FT                   54 modulation protein / S30EA ribosomal protein; TIGRFAM:
FT                   ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32985"
FT                   /db_xref="GOA:E4TYK8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK8"
FT                   /protein_id="ADR32985.1"
FT                   /translation="MNISLVGRHIELSDAIKDHLMHSIDTLTKYHLDLISVNAVASANE
FT                   RKKGVTIEFTINVAGKNTIVITQRDDDLYAAIDIAIDRAQKALRRLHDRLSDHKNEGLN
FT                   EAKLAASNSIDLHAATEAMEDEIVPAEPILFKPQEVAEILEKLKESGKVFEVFYDIDGK
FT                   MRVLYKRSDGRFGLY"
     atgaatatct ctctcgtcgg acgccacatc gagctcagcg atgccatcaa agatcatctg        60
     atgcactcta tcgatacact aaccaaatac catctcgacc ttataagcgt caatgccgtc       120
     gccagtgcaa atgaacgtaa aaaaggggta acgatcgaat ttacgatcaa tgttgccgga       180
     aaaaatacta ttgtcatcac ccaacgcgac gacgatctct acgccgcgat cgacatcgcg       240
     atcgaccgtg cccaaaaagc gcttcgccgt ttgcacgacc gactctcgga tcataaaaac       300
     gaagggttga atgaagccaa attagcggca tccaattcca tcgatctcca tgccgcaacc       360
     gaagcgatgg aagatgaaat cgtccctgcc gaaccgatcc tttttaaacc gcaagaggta       420
     gccgaaatat tagagaagct caaagagagc ggcaaagtat ttgaagtctt ttatgatatc       480
     gacgggaaaa tgcgtgttct ttataaacgt tcagacgggc ggttcgggct ttattaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page