(data stored in ACNUC7421 zone)

EMBL: CP002355.PE318

CP002355.PE318       Location/Qualifiers
FT   CDS_pept        309291..313022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0319"
FT                   /product="conserved repeat domain protein"
FT                   /note="InterPro IPR001434; KEGG: sun:SUN_1908 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   conserved repeat domain protein; TIGRFAM: conserved repeat
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32986"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYK9"
FT                   /protein_id="ADR32986.1"
FT                   /translation="MKINKLFLRWMTTFGMVMVCTTFGHSAEVAFNTPYYSTNVNGDMT
FT                   TLGNTIVWKDTVAANAYGVDVSTSIPTDRNNAYNMKFIDVLSDGVTTFNSSSSSLDLPA
FT                   GCTVKWAGLYWQGHIVNKNLEGGADNSKIGTGVNNTAVYDDAKSKANTVYFRRPDGTSY
FT                   NLTAQVFYDYPTDISGGKDRRYLYSGFYNVTNYVKAVGSGSYTVGNIRTSEGTIATWGG
FT                   LGGWAMLVIYEDITGTLQLKNVSVFHGYRVLNSGDVQDINVNGFLTPSGGTINASLAIF
FT                   VADGDKLGSNSTGEHLKIWNTSSVLTDIVNGTNPLNNVFNSTITNLGVDNVTRTPNFTD
FT                   NLGIDIDRFDVSSYMNHSQNNTRIQVSTVGDLYTIDLIAFATDIYQPFISIAKSTDSSG
FT                   TVTSNQTITYTANIKNTGNEGASNIVIYDNFDDNNLTKIDGNITNPLVTLGDLLDHNTT
FT                   TILDSVVCNYGPSHTDCKSLCTVGLSPFKIACSIPSMAVGETAFMQFQTKIASNPDTHG
FT                   QSVKVENKMYATYYNALTGAAVDQTSSNLADAGQYLYAQNIPASGFDARETSIAEADND
FT                   RSIKTKIVNKTFQLNIVSLDTAGAIAPYTVPTGNRVYLFPVDSSLCLLSDSEKLTQIES
FT                   LPRNTYVDFANGDTTKPSPAIDLSNALLSAVAGRDKRIALNYVDWGTSFQAASFSCSNS
FT                   NTQAVLLGVPQCLNADHKIGDVFGQLTQDVCAGGAAHGMNPALANPPCQSNSYTAGNLP
FT                   SAPFDNAYGCYQCIAGMAGKVSCSTDNFAIRPDHFSFTAPVAKMKAGEDYSLNVIAYDN
FT                   NGNSAQEYDQSVANLAGAPATWWQRDANVVLNPVNTQGTITISGAGTFSNGAGAVPIRY
FT                   SDVGKFTLELKDSNWAAVDLTDTGITENEYTIQGDRNVTFIPYDFNISVGRIVNNDGAT
FT                   PSFTYLSSDLNMSARIPMTIRAQNKQGALTQNYANNLYERTITITPHVASVVATARGLV
FT                   PKTVGATNADANFVSGSTSIVFNDPLAAKFNFSRDPRVVVSPFDVNSSNGVGNDVNVSI
FT                   VDADNVYGDKNRTLIGNATFVYGRFIPRDIRVFGNVPFSANGWYEVFNAPKINGIILTP
FT                   SKNESMWYINHLHNDVTFGDANITSVLAATHTALPVSSISNGTGMESYQFNAETPPYSS
FT                   KAHIKTKPWLWYGPSASAYADPGTDCSTHPCFNIAVVPSVGATGSSKDQNVGSKTNKST
FT                   SDGAGVWKSTRDYAPAIR"
     atgaaaataa ataaactttt tttgcggtgg atgacaacat ttggaatggt aatggtgtgc        60
     actacatttg gacatagtgc agaagtagca tttaatacac catattatag cacgaatgtg       120
     aatggtgata tgacaacatt gggtaacact attgtttgga aagatactgt cgcagctaat       180
     gcttacggcg tggacgtgag tacatctata ccaactgatc gcaataacgc ttataacatg       240
     aaatttatcg atgttctatc agatggagtg acgacattca attcgtctag ctcatctcta       300
     gatttacctg ctgggtgtac agttaagtgg gctggtcttt attggcaagg acatattgta       360
     aataaaaatt tagaaggtgg tgcagataat agtaaaatcg ggacaggtgt taataataca       420
     gctgtttatg atgatgctaa gagtaaagcc aatacagttt attttagacg tccggatggt       480
     acaagttata atttgacagc acaagtattt tatgattatc ctacagatat tagcggggga       540
     aaggatagac gatatttata tagtggtttt tataatgtta caaattatgt taaagcagta       600
     ggcagcggta gttatacagt aggaaatatc cgtacgtcag aaggaacaat tgccacatgg       660
     ggtggccttg gtggatgggc aatgctggtt atatatgaag atataacagg gacattacag       720
     cttaaaaatg tatcagtatt ccacggttat cgggttttaa attcaggtga tgtacaagac       780
     ataaatgtaa atggcttttt gacaccatcg gggggaacga ttaacgcttc tctcgctatt       840
     tttgttgctg acggggataa attaggttca aacagtactg gggaacattt aaaaatatgg       900
     aatacttcta gtgttctgac agatattgta aacgggacga atccgcttaa taatgttttt       960
     aactctacta ttacaaattt gggagttgat aatgttacga ggacgccaaa tttcacagat      1020
     aatttgggta ttgatatcga tcgttttgat gtcagcagtt acatgaatca ttcacagaac      1080
     aatacaagga tacaagtaag tacagttggg gatctttata caattgattt gatagctttt      1140
     gccaccgaca tctatcaacc gtttatctct atcgcaaaat caacagacag tagtgggact      1200
     gtgacatcaa atcagacgat tacttatacg gctaatatta aaaatacagg aaatgaaggg      1260
     gcaagtaaca ttgttattta tgataatttt gatgataaca atttgacaaa aattgatggc      1320
     aatatcacca atccattggt gacgttaggt gatttattgg atcataatac gacaactatt      1380
     ttagattcgg tcgtatgtaa ttacggccct tcgcatacgg attgtaaaag tttatgtacc      1440
     gtaggtttaa gcccgtttaa aatcgcatgt tctattccat cgatggcggt gggagagaca      1500
     gcctttatgc agtttcaaac gaagattgca tccaatcctg atacacacgg gcaaagtgta      1560
     aaagttgaaa acaagatgta tgcaacgtac tacaatgcgc tcaccggagc ggcagtcgat      1620
     caaacctctt ccaatcttgc cgatgcgggg cagtatttgt atgcacagaa tataccggcc      1680
     agcggttttg acgctcgaga gacgtcgatt gccgaagcgg ataacgatcg atccattaag      1740
     acgaagatcg tcaacaaaac gtttcagctc aacattgtct ctctcgatac ggcgggggcg      1800
     atcgctcctt ataccgtacc gacgggaaac agggtctatc tattcccggt agattcgagt      1860
     ctctgcttgc tctcggatag cgaaaaatta acgcagatcg aatcgttgcc gcgcaatacg      1920
     tatgtcgatt ttgccaatgg ggacacgacg aaaccttcgc ccgcaatcga tctctccaat      1980
     gcgctgctca gcgcggtggc ggggagagat aaacggatcg cattgaacta tgtcgactgg      2040
     gggacaagtt ttcaggccgc gagtttcagt tgcagcaaca gtaacacgca agccgtgttg      2100
     ttgggggttc ctcagtgttt gaacgcagat cataaaatcg gagatgtttt tggtcaattg      2160
     acacaagatg tgtgtgcggg cggtgcggca cacgggatga atcccgcttt ggcgaatcct      2220
     ccgtgccagt cgaacagcta tactgccgga aatctcccat ctgccccttt tgacaacgcg      2280
     tatgggtgct atcaatgtat cgccggaatg gccggaaaag tgagctgttc gaccgataat      2340
     ttcgcaatcc gtcctgacca tttttctttt acggccccgg tggctaagat gaaagcgggt      2400
     gaggattata gtctgaatgt tattgcatat gacaataatg gcaatagcgc gcaagagtat      2460
     gatcaaagtg ttgctaatct agccggtgct cctgctacat ggtggcagag ggatgcaaac      2520
     gtcgtgttaa atccggtcaa tacccaaggg actattacga tttcgggggc tggaactttt      2580
     agtaatggtg caggtgcagt tcctatacgc tatagcgatg tcggaaagtt tacattggaa      2640
     ttgaaagata gtaattgggc ggcagtcgat ctaactgata cgggaataac agagaatgaa      2700
     tataccattc aaggagatag gaatgtgacg tttatcccgt atgattttaa tatctcggta      2760
     gggaggattg tcaataatga cggtgccact ccctccttta cctatctctc cagtgatttg      2820
     aacatgtctg ctcgaattcc tatgacgata cgggcacaaa acaagcaggg tgcgctaacg      2880
     caaaattatg ccaataattt gtatgagaga accattacca ttaccccgca tgttgcctcg      2940
     gttgttgcaa cagcgcgggg attagttccg aaaacggttg gggcaacgaa tgcggatgct      3000
     aattttgtaa gcggaagtac atcgatcgtc tttaatgacc ctttggcggc aaagtttaat      3060
     ttttccagag atccgagagt ggttgtctct ccgtttgatg tgaacagttc caacggtgtc      3120
     gggaatgatg taaatgtcag tattgttgat gcggacaatg tctatggcga taagaaccga      3180
     acactgatcg ggaatgccac ttttgtctac ggccgattta ttccccgtga tattcgagta      3240
     tttggaaatg tccccttttc cgccaatgga tggtatgaag ttttcaatgc accgaaaatt      3300
     aacggaatca tattgactcc cagcaaaaac gagagtatgt ggtatatcaa tcatttgcat      3360
     aacgatgtaa cgttcggaga tgccaatata acatcggtgc ttgcggctac acatacggcg      3420
     ctgcctgttt caagcatatc caacggtacg ggtatggagt cttatcaatt caatgcggaa      3480
     acaccgccgt acagttcaaa agcgcatata aagaccaaac cgtggctatg gtatggaccg      3540
     agtgcatctg catacgccga tcccggcacg gattgctcga cccatccgtg ttttaacatc      3600
     gcagtggttc cctcagtcgg ggccaccgga agttcaaaag atcaaaatgt cggttcaaaa      3660
     accaataagt ctacgagcga tggagcagga gtgtggaaaa gtacccgaga ttacgctccg      3720
     gcgatccgat ga                                                          3732
//

If you have problems or comments...

PBIL Back to PBIL home page